KEGG   Asparagus officinalis (garden asparagus): 109848765Help
Entry
109848765         CDS       T05243                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109848765
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109848765
Protein kinases [BR:aof01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   109848765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Pkinase_C APH FTA2 Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 109848765
NCBI-ProteinID: XP_020274010
LinkDB All DBs
Position
7
AA seq 485 aa AA seqDB search
MVSPQISGLNKTRNQKAFNKQLLLPMGPPDVIPSESVEFDFSDVFGPSPTQTSIEVNVVT
SDSSVAAASEDIVYNEPVVILSRSHSLVGPTALVCQSPRLRIHTLHETDLELIECPSGGE
GKQERPSSCTAGEHEETSQSENVESVGLDDFDFLKVVGQGAFGKVFQVMKKGTSEVYAMK
VVRKDKIIEKNHFEYMKAERDILTKVDHPFIVQLRYSFQTKYRLYLVLDFVNGGHLFFQL
YHQGLFREDLARIYTAEIVSAVSHLHANGIMHRDLKPENILLDADGHVMLTDFGLAKEFE
ENTRSNSMCGTVEYMAPEIVLGRGHDKAADWWSVGILLFEMLTGKPPFIGGNRDKIQQKI
VKDKIKLPAYLSSEAHSLLKGLLQKEASRRLGSGPAGSNEIKNHKWFKSINWRKLEAREI
QPSFRPNVAGKICVANFEEKWTSMPLTVSPVASPVGGSNFNGFTYVNPSVFLQKPSPLSS
EPESS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtttctccccagatatcgggtctgaacaagacaaggaaccagaaagctttcaataaa
caattgcttcttcccatgggcccacccgatgttattccttctgagagtgtggaattcgat
ttctctgatgtttttggcccatcgccaactcaaacctcaattgaggtgaatgtggtgact
tccgatagttctgtagctgctgcttcagaagacatagtttacaatgaacctgtggtgatt
ttgagccggtcacattctctggtcggacccacagcacttgtatgccaatctccacggctc
cgcatacacacattgcatgagactgatttagagctcatagagtgtccctctggaggagaa
gggaaacaggagagaccatcttcatgcactgctggagagcatgaagagacatctcagtct
gagaatgttgaaagtgtgggacttgatgattttgatttcttgaaggttgtcggccaaggg
gcatttggaaaagtgtttcaggtgatgaaaaaaggaacatcagaagtatatgcgatgaag
gtcgtaagaaaggataagattatagagaagaatcactttgaatacatgaaagctgagagg
gatatattgacaaaagttgaccaccccttcattgttcagctcagatactctttccagaca
aagtatcgattgtaccttgtgctagattttgtcaatggtggacaccttttctttcagcta
tatcatcaaggattattcagagaggatttggcacgtatttacactgctgaaatagtgtct
gctgtttcccaccttcatgcaaatggaataatgcatagggacctcaaacctgagaacatc
cttcttgatgctgatggccatgtcatgctgactgactttggtctagcaaaagaattcgag
gaaaacactagatcaaactccatgtgtgggacagttgagtacatggcacctgaaatagtt
cttggaaggggccatgataaagctgctgattggtggagtgtaggaatcctgctgtttgaa
atgctgactggaaagcctcctttcattggtggcaatcgggacaaaattcagcagaaaatc
gtgaaggataagataaagctgcccgcttacttatccagtgaggctcactcactattgaaa
gggttattacagaaagaagcaagcaggcgtctgggcagtggacctgctggcagtaacgaa
ataaagaaccataagtggttcaagtctatcaactggaggaaactggaagctcgagaaatc
cagccaagcttccgtccaaatgtagcaggcaagatttgcgtggctaactttgaagagaaa
tggacgagcatgccattgacagtctctcctgtggcaagtccagttgggggaagtaatttc
aatggatttacatacgtgaatccttctgtttttcttcagaagcccagtcctctctcttct
gaacccgagtcctcttag

DBGET integrated database retrieval system