KEGG   Acanthaster planci (crown-of-thorns starfish): 110978247
Entry
110978247         CDS       T05078                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00230  Purine metabolism
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110978247
Enzymes [BR:aplc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110978247
SSDB
Motif
Pfam: Guanylate_cyc AC_N DHOase DUF1053
Other DBs
NCBI-GeneID: 110978247
NCBI-ProteinID: XP_022088757
LinkDB
Position
Unknown
AA seq 1070 aa
MRGTKSHLGGGETPIITADMETGQELEMSTTDADIAKMKRRERRKSRQSVGDFWYQCLPG
WLRYQFKSPSMEATYQTYFTRQRRDALPVLAGFALLFDLVVLALYIYKKLTVAIAIMAIT
TVTNLIVFALCQYKLVTDWTLLHIMPYAVWLLLTGQTAVDLFFFYKPLSPSDGVGWQVFF
IFASFVMLPVRLRYILVLSLLNIVVHSVMVGVLSRVYVSNLGVQLASNLMLYACSMIVGC
IVFLMADRKQRRAFVETKAALEIKLTLQEQSTQQEELLLSVLPKHVADDMMKDMGTVNKG
QFNRIYIKRHENVSILFADIVGFTAMSSKMSAKELVKTLNALFANFDKLAEKHHQLRIKI
LGDCYYCICGVPEQRQDHAACCVQMGLDMVVAIAAVREKTQSGVDMRVGIHTGAVLAGVM
GQQRWQFDVWSTAVVLANHMESGGIPGRVHISQDTFGCLNGEFEVEPGEGETRDDYIKDQ
GIKTYLIKVNKDNVKKAAAFTSIILSDDGSTTKRSEEEESDVKANDANGKTVTFDEEVPE
PKPDEGITNRKLYEALVEREADAAKTSGMRRFSLWFRDKTLEDTFHREKERQSPVGFCCA
IIIMVFGFCVQMMVLPRTTASYVTFAVGLFLLVLIFYISMATSFKNRYPDTLVCVSSWME
STYVARTLIVTCVAVIVAASDVVDMVVCELGDSKIETLDTQSPMCIYGRYYTYTGILVLV
TITVMIHVTQFIKMILILLIGLVYTLLNLVFYKEIFIRYDNYQLEQVSTLSLTDNPNEFP
SRYVITYQLLAAGFALIFYNRFLEVTNRLLFYWKYETRKQKEEVGKLRIRNEVLVLNIMP
IHVAKHFLRNKRKDEDLYAQDYPEVGVMFASIPNFSEFYSEDTINNQGTECLRFLNEIIS
DFDTLLKAVRFRSICKIKTITSTYMASSGMVAEPEKIIYEGEQERWQHLADLVNFAFALR
DTLDTINQQSFNNFIMKVGINHGPVLAGVIGARKPHYDIWGNTVNVASRMESTGKAGFIQ
VIEETMKVLKRFGFKFQQRGYVKVKGKGELLTFYLIGKEEKDDLLPNMIV
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgaggggcaccaagtcccacctgggcgggggggagaccccaatcatcacggcggacatg
gagaccggccaggagctggaaatgagtaccacagacgcggacatagccaagatgaagcgt
agggagcggagaaagagccggcagtccgtgggcgacttctggtaccagtgcctgccagga
tggctccgctaccaattcaaatcgccctcaatggaggcgacctaccagacctacttcaca
aggcagaggagggacgctctgccggttctcgccggctttgccctgctctttgacctcgtg
gttctcgccctgtacatctacaagaaactgactgtggctatagccattatggccatcacc
accgttaccaatctgatagtgttcgctttgtgccaatacaaacttgtaacggattggacc
ctcttgcacatcatgccgtacgcggtctggctcctcctgacgggacagacagcagtcgac
ttgttctttttctataagccattgtcgcccagtgatggtgttgggtggcaggtgttcttc
atattcgcctccttcgtcatgttgccggtccggcttaggtacattctggtgctaagtctt
ctcaatattgttgtgcacagtgttatggtgggagtgttatccagggtttatgtctccaat
ctaggagtgcagctggcgtccaacctgatgttgtacgcatgctccatgatcgtcggctgc
atcgtgtttttaatggccgacaggaaacagaggcgagcgttcgtggaaaccaaagcggcc
ttagagatcaaacttacgctacaggagcaaagcacgcaacaggaagagctcctgctctct
gtattgcccaagcatgttgctgacgatatgatgaaggacatgggtacggtcaacaaggga
cagttcaatagaatctacattaagagacacgaaaacgtcagcatcctctttgctgatatc
gtgggattcacggccatgtcctccaagatgtctgcaaaggaacttgtcaaaacgctcaat
gccttatttgcaaattttgacaagctggctgagaaacaccaccagctgaggatcaagatc
ttaggcgactgttattactgtatttgtggtgttccagagcagcgacaggatcatgctgct
tgctgtgtacagatggggcttgacatggtggtagcaatcgccgccgtgagggaaaaaacg
cagtctggagtggacatgcgtgttggaatccacactggcgccgtgctggccggggtcatg
ggtcaacagaggtggcagtttgacgtatggagcaccgcggtggtgctggccaatcacatg
gagtctggcggcatacctggtcgtgtgcatatctcgcaggacacctttgggtgcctgaac
ggtgagttcgaggttgaaccaggcgagggggagacacgcgacgattatatcaaggaccaa
ggtatcaagacctatctcattaaggtcaacaaggacaacgtaaagaaagccgctgctttt
acctccatcattctctcagacgatggatcaacgacgaagaggtcagaggaagaggaaagt
gacgtaaaggctaatgatgcaaacggcaagactgttacctttgacgaggaggtaccagaa
ccaaagcccgatgaagggattaccaatcgtaaactgtacgaggcactagtggagagagaa
gcagacgcagcaaagacgagcggcatgcggaggttttccctctggtttcgggataagact
ttggaggacacattccaccgggaaaaagagcgacagagccctgtgggtttttgctgtgcc
atcatcatcatggtctttggcttctgtgtgcagatgatggtcttgccgagaaccacagcg
agttacgtcacatttgccgtaggcttatttttgttagtcctgatcttctacatatcgatg
gcaactagcttcaagaacaggtacccagacacactagtctgtgtgtcaagctggatggag
agtacgtatgtggcaaggacactgatcgtcacgtgtgtcgcagtcatcgttgctgcatct
gatgttgttgacatggttgtatgcgagctgggggactccaaaattgaaactctggacaca
cagagcccaatgtgcatatacgggcgatattacacatacacgggtatactggttctggtc
accatcactgtgatgatacatgttacgcagttcatcaagatgattctgatcctgcttatt
ggcttggtgtataccctcctcaatctcgtcttctacaaggaaatatttatcagatacgac
aattaccaattagagcaagtgagcacgctaagcctaactgataatcccaatgagtttccc
agtcgttacgttatcacataccagcttctcgcagccggctttgcacttatcttctacaac
agatttctagaagtcaccaataggttactcttttactggaagtacgagacgcggaaacaa
aaagaagaagttggcaaattacggatacgaaacgaggtgctggttctgaacatcatgccc
atccacgtggccaagcacttcttacggaacaaacggaaagacgaggatctctatgcccag
gactacccggaggttggtgttatgttcgcctctatcccaaacttctccgaattctacagc
gaggataccatcaacaaccaaggcacagagtgtctccggttcttgaatgaaatcatcagc
gactttgatacgcttctgaaagcagttcgtttccggagcatctgcaagatcaagacgatc
accagcacctacatggcgtcgtcggggatggtggctgagccggagaagattatttacgag
ggagagcaggagcgctggcaacaccttgccgatctcgtcaactttgccttcgctctcagg
gacaccttggacaccattaaccagcagtcgttcaacaacttcatcatgaaagtcggtatc
aatcatggtccagttcttgctggagtcattggagccaggaaaccacactacgatatctgg
gggaatacagttaacgtagccagccgcatggaaagcacagggaaagcaggatttatccag
gttattgaagaaacaatgaaggtactgaagaggttcggtttcaagtttcagcagaggggt
tacgtcaaggttaagggcaaaggtgaactcttgaccttttacctaattggtaaggaggag
aaggatgacctgctaccaaatatgatcgtataa

DBGET integrated database retrieval system