KEGG   Acanthaster planci (crown-of-thorns starfish): 110986600Help
Entry
110986600         CDS       T05078                                 

Definition
(RefSeq) phosphopantothenate--cysteine ligase-like isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00770  Pantothenate and CoA biosynthesis
aplc01100  Metabolic pathways
Module
aplc_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    110986600
Enzymes [BR:aplc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     110986600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 110986600
NCBI-ProteinID: XP_022104278
LinkDB All DBs
Position
Unknown
AA seq 340 aa AA seqDB search
MSTARSLLQNTEREKDGSSKLSQGTENKKKDEWEVFFESHEPPADFADKKLRMHEFAEGH
MKNGTRVVLVTSGGTAVPLENKMVRFIDNFSSGKRGAASAEQFLSEGYAVIFLHRHKTLI
PYERHLANTRLTDILDIRKDPDGTQQIVANQEKFPKLLSILQGYKEVQASNSLLLIEFTV
LQEYLYLLQAAAEALSFAGTHAMFYLAAAVSDFYIPSQEMIEHKIQSADGPPNITLHVVP
KMLTPLVRHWAPEAFVVSFKLETDRSLLLDKARQALEKYNHQVVIANILEERNEWVTMVT
PEEYQKLSITDKSWSCIIEELIIPDLVTKHTVFIVNNSSD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgctagaagtttgctgcagaacacggaacgggagaaagatggcagtagtaag
ttgtctcagggcacagaaaacaaaaagaaggatgagtgggaagtgtttttcgagtctcac
gagccaccggccgacttcgccgacaaaaagctgcgtatgcatgagtttgcagagggtcac
atgaagaatggtacacgggtcgtacttgtgacttctgggggaactgctgtacctctggag
aacaagatggttcgtttcatcgataacttcagctctgggaaaagaggtgcagcgtctgcc
gaacagttcctttcagaaggatacgccgtgatcttcctacataggcacaagacactaatc
ccctatgaacgccaccttgccaacaccagattgactgatatattggacatacggaaagat
ccagatggcacacaacaaatagttgccaaccaagagaaattccccaagctcctgtccatc
ctgcaaggttacaaggaggtccaggcctccaacagcctcctcctaattgagttcacggta
ctacaggagtacctgtacctcctccaggctgccgctgaggctctgtcctttgcaggtacc
catgccatgttctaccttgccgcggccgtgtcagacttctacatccctagccaggaaatg
attgagcacaaaattcaatcagccgatggtccacctaacatcaccctccatgtggtgccc
aagatgctgactccgttggttcgccactgggccccagaggcctttgttgtgtcgttcaaa
ctggagacggatcggtcgttgctgttggacaaggccagacaagccttggaaaagtacaac
caccaggtggttatagctaatattctagaggagcgcaacgagtgggtaaccatggtaaca
ccggaagaataccagaagctgtccatcacagacaaaagttggtcctgcatcattgaggag
cttattatacctgatctggtcaccaaacacactgtgttcattgtcaacaactcaagcgac
tga

DBGET integrated database retrieval system