Actinosynnema pretiosum: CNX65_18120 Help Entry CNX65_18120       CDS       T05092                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism apre  Actinosynnema pretiosum Pathway apre00261   Monobactam biosynthesis apre01100   Metabolic pathways apre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CNX65_18120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:apre01008]     CNX65_18120 Polyketide biosynthesis proteins [BR:apre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CNX65_18120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATE54964 UniProt:  A0A290Z7K3 LinkDB All DBs Position 4220583..4220786 Genome browser AA seq 67 aa AA seqDB search MTQDERVYRVVVNDEEQYSIWPADRDLPPGWVADGTEGPRAACLAHVERVWTDMRPRGLR ERMGQLG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgacgcaggacgagcgggtgtaccgggtcgtggtcaacgacgaggagcagtactcgatc tggcccgccgaccgcgacctgccccccggctgggtcgccgacgggaccgaggggccgcgc gcggcgtgccttgcgcacgtcgagcgggtgtggacggacatgcgaccgcgcggcctgcgc gagcggatggggcagctgggctga

DBGET integrated database retrieval system