KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_02870
Entry
APA26_02870       CDS       T01816                                 

Gene name
chvG
Definition
(GenBank) two component sensor histidine kinase ChvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APA26_02870 (chvG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apx01001]
    APA26_02870 (chvG)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:apx02022]
    APA26_02870 (chvG)
Enzymes [BR:apx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     APA26_02870 (chvG)
Protein kinases [BR:apx01001]
 Histidine kinases
  OmpR family
   APA26_02870 (chvG)
Two-component system [BR:apx02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   APA26_02870 (chvG)
SSDB
Motif
Pfam: HATPase_c HisKA Sensor_TM1 Stimulus_sens_1 HAMP dCache_1 HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: BAI10633
LinkDB
Position
complement(298165..299967)
AA seq 600 aa
MTSPPAPSFFKALAGRIGGLHYLSMPGNKPRKGSIEATAAYQASRTRLISPLMRRVLLVN
ILPIALLGVTILFLNQFRNGLLATEVTALREQARIYAGALGQSAVRAAHPHATNPQDRDY
VLEESLARPLLLRLTEPSPNAHARLFGPDGRLVADNLADWPETAEPAPATPRNEQRVKTI
PFPPATQPGIYERFLTWLWGSHNSGIVTLNTDEEDIPARPSGTAVGTKGAPPPPPLEAPP
YIRRTARGRLIITVAEPVMHDGSTIGIIQLTRVASQVDRSLFAIRSSILSVFLMALVLTV
LLSWYLSLTIARPLLRLAASAQVMRDATGRTGTVPARLLARRDEIGDVARALQASAQALW
KRMDAIERFAADVSHEIKNPLSSIRSAIETLLRIEDLNQQRRLLTIINDDVRRLDRLITD
ISDASRLDAEMSRAKAEPVAIAPLLSVLAEIQQATRQDGQPIVQTNVQGDTPESPLEVLA
VEDRLVQVLRNLIGNAISFSPPNGHITLSAMPTGKMVTISVADEGPGIPQAKLDSIFDRF
YSERPKNENFGQHSGLGLSISRQIIEALHGTISVDNLHNQNGQVIGACFTIQLPRVIVTR
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaccagcccgcccgccccttcttttttcaaggcgctggcaggccgcattggtggcctg
cattatctgtccatgccgggcaacaaaccccgcaaaggcagtatagaagccacagcggct
tatcaggcctctcgcacacggctgatttctccgctgatgcggcgggtcttgctggttaac
attttgccaattgccctgctgggcgtgaccattctgtttctgaaccagtttcggaacggc
ctgctggcaacagaagttaccgccctgcgtgaacaggcccggatttatgcgggcgcattg
gggcaaagtgccgtacgcgccgcacatccccatgctactaatccgcaggatcgtgactat
gtgctggaagaatctctggcccgcccattgctgctgcggctgacagaaccaagccccaac
gcccatgcccgcctgtttgggccagatggccgcttggtggctgacaacttggcagactgg
cccgaaacggcagaacctgccccagccacaccgcgcaatgagcaacgtgtcaaaaccatt
ccttttccaccggccacgcagcccggcatttatgaacggtttctgacatggctatggggc
agccataattcgggcattgtcacgctgaacacggatgaggaagatattcctgcccggccc
tccggcacagctgtcggcacaaaaggcgcaccgccgccaccgccgctggaagcgccgccc
tatatccggcgtaccgcacggggccgcctgattattacggtggctgaacctgtcatgcat
gatggcagcaccattggcattattcagctgacccgcgtggcctctcaggttgatcggtcc
ctgtttgccattcggtcttccattctgtccgtttttctgatggctcttgtgctgacggta
ctgctctcgtggtacctctctctcaccattgcgcggccactgttgcggctggccgcatca
gcacaggttatgcgtgatgcaacaggccgcactggcaccgtgcccgcacgactgctggcc
agacgtgatgaaattggtgatgtggcacgtgccctgcaagccagcgcacaagcgctctgg
aagcgtatggatgccattgaacgctttgccgctgatgtcagccacgaaattaaaaatccg
ctgtcctccatccgctcggccattgaaacactgctgcgtattgaagacctgaaccaacaa
cgccgcctgctgaccattatcaacgatgatgtgcgcaggttggaccggctgattaccgat
atttcagacgccagccgtctggacgccgaaatgtcgcgcgctaaggctgaacctgttgcc
attgcgccgctgctttctgttttggcagaaattcagcaggctacccggcaagatgggcaa
cccattgtgcaaacaaatgtgcagggtgataccccagaaagcccattggaagttctggct
gtagaagatcgtcttgtgcaggttttgcgcaacctgattggtaatgccatttccttttct
ccgcccaacggccacatcacgctctcagctatgccaacaggcaagatggtcaccatttct
gtggcagatgaaggcccgggcattccgcaggccaagctggattcgatttttgaccgcttt
tattccgagcgcccgaagaatgaaaatttcggccaacactcaggcttggggctttccatc
agccgtcagattatagaagccctgcacggcacaatttccgttgataatctgcacaaccag
aatgggcaggttattggagcctgttttaccattcagctcccacgggtcattgtcactcgt
tag

DBGET integrated database retrieval system