KEGG   Arthrobacter sp. YN: CGK93_16385Help
Entry
CGK93_16385       CDS       T05171                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
arn  Arthrobacter sp. YN
Pathway
arn00564  Glycerophospholipid metabolism
arn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGK93_16385
Enzymes [BR:arn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CGK93_16385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 AlaDh_PNT_C Pyr_redox 3HCDH_N Herpes_UL4
Motif
Other DBs
NCBI-ProteinID: ASN21083
UniProt: A0A221NM67
LinkDB All DBs
Position
complement(3573889..3575643)
Genome map
AA seq 584 aa AA seqDB search
MSNVAGGPQAGYPGALSPEARAASIEVLKATAEAGKELDILIVGGGVVGAGAALDAVTRG
LTVAIVEARDWASGTSSRSSKLIHGGLRYLEMLDFGLVQEALQERGLLIQQIAPHLVRPV
PFLYPLTRRFWERPYVGAGIMLYDTLGLTSGHSRGVPMHKHLFKRGTLRAAPSLKDDAFV
GSIRYYDAQVDDARLVVNVVRTAAHYGAHAANRLRVVDFLREGERVVGAKLENQEDGSVF
QVRAKQVVNATGVWTDETQAMVTDRGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVL
FVIPWGRHWIIGTTDTDWTLDKAHPAASSKDIDYVLEHVNKVLKRPLTREDVEGVYAGLR
PLLAGENDSTAKLSREHVVAHPVPGLVVVAGGKYTTYRVMAKDAVDEATRAMDERVPSSC
TETIPLLGAEGFKAAWNRRGRSAEEAGVHVARVEHLLNRYGSMTPEVLELISKRPELGEP
LPGADDYLAAEVVYATTHEGARHVHDVLTRRTRISIESWDRGVAALPVVAKLMGEILGWS
ENQRESEIKHYLARVEAERLSQQQPDDESADAARMGVDDIVPLR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtcgcaggcggtccacaggcgggttatccgggggccttgagcccggaagcc
cgtgccgcatcgatcgaagtcctgaaagctacggccgaggccggcaaggagcttgacatc
ctgatcgttggtggcggcgtggtgggggccggagccgccctggatgccgtgacccgcggc
ctcaccgtagccattgtggaggcccgggactgggcgtccggtacctcatccaggtcctcc
aagctcatccacggaggtcttcgatacctggaaatgcttgatttcggcctcgtccaggag
gctctgcaagaacggggactgctgatccagcagatcgccccccacctggtccgccccgtg
cccttcctgtatccactgacgcgcaggttctgggaacgtccctacgttggtgccggaatc
atgctttacgacacgttgggcctgacctccggacacagccgtggcgtccccatgcacaag
cacctcttcaagcgcggaaccctgcgcgcggctcccagcctgaaggatgacgcgtttgta
ggctccatccgctactacgacgcacaagtggacgatgcccgtctggtggtcaacgtggtc
aggaccgcggcccattacggcgcccatgccgccaaccggcttcgggtggtggacttcctt
cgcgagggtgaacgtgtggtgggggcaaagcttgagaaccaggaggacggcagcgttttc
caggtccgggccaagcaagtggtcaacgcaacgggagtctggacggacgaaacgcaggcc
atggtgacggatcgcggccaactcaaagtccgcgcctccaaaggcattcacttggtggtg
ccgcgcgaccgcttccaatcaacagtgggcctgatcctccgtacggaaaaatcggtgctt
tttgtgatcccttgggggcgtcactggatcatcggcaccacagataccgactggacgctg
gacaaggcgcatccggctgcttccagcaaggacatcgattacgtcctggagcacgtcaac
aaagtcctcaagcgtcccctgacccgtgaggacgtggaaggagtttacgctggcctccgg
cctttgctggccggcgagaacgactccacggccaagctctcgcgcgagcatgtggtggca
catcccgttcccggtcttgtggtggttgccggcggcaaatacaccacttaccgggtcatg
gccaaggacgccgtggacgaggccaccagggccatggacgagcgtgttccctccagctgc
accgagaccattccgctcctgggagccgaagggttcaaagctgcctggaaccggcgcggg
cgttctgcggaagaagccggcgtccacgtcgcccgggttgagcacctgctgaaccgctac
gggtccatgactcccgaagtgctggaactgatctccaagcgaccggaactgggggagcca
ctgcccggtgccgatgactacctcgccgcggaagtcgtctacgccacaacccacgaggga
gcacgccatgtccatgacgttttgacgcgtcgaacccggatctcgatcgaatcgtgggac
cggggtgtggcagccctcccggtagtagctaagctgatgggagaaatccttggctggagc
gagaatcagcgcgaaagcgagatcaagcactacctggcacgcgtagaagctgaacggctc
agtcagcagcagcctgacgacgaatcggcagatgccgcgcgcatgggagtggatgacatc
gttccccttcgctga

DBGET integrated database retrieval system