KEGG   Arthrospira platensis: NIES39_B00640Help
Entry
NIES39_B00640     CDS       T02608                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
arp  Arthrospira platensis
Pathway
arp00010  Glycolysis / Gluconeogenesis
arp00020  Citrate cycle (TCA cycle)
arp00620  Pyruvate metabolism
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01120  Microbial metabolism in diverse environments
arp01130  Biosynthesis of antibiotics
arp01200  Carbon metabolism
Module
arp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES39_B00640
   00020 Citrate cycle (TCA cycle)
    NIES39_B00640
   00620 Pyruvate metabolism
    NIES39_B00640
Enzymes [BR:arp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES39_B00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: BAI88821
UniProt: D5A161
LinkDB All DBs
Position
complement(962662..963957)
Genome map
AA seq 431 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWQKSPGDRVGKGETVLIVESDKADMDVEAFYEGFLATII
VPEGGTAGVGQTIALIAETEAEIEEAKKQATTTATTSTTTPPPKATPTPSVATPEPVAAT
VAIENTPSRRNGRIVASPRARKLAKQLNVDLNNLQGTGPHGRIVAEDVEVATGRAQTPTV
APQPTVSPVATPSPISTIPTPAPAPVPLGEVVAMNTLQNAVVRNMLVSLQVPTFHVGYTI
TTDNLDKLYKQVKSKGVTMTALLAKAVAIAIQKYPIVNASYVDSGIQYNKGINIAVAVAM
PDGGLITPVLSNADQIDIYSLSRTWKDLVARARSKQLQPQEYSSGTFTLSNLGMFGVDRF
DAILPPGQGSILAIGASRPTVVATDDGMMGIKRQMQVNITCDHRIIYGADAAAFLQYLAQ
LIETNPQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaagtgtttatgcccgccctcagttcgactatgacagagggtaaaattgta
tcgtggcaaaaatccccaggcgatcgcgtcgggaaaggggaaaccgtcctgattgtagaa
tccgataaggctgatatggacgtagaagccttttatgaaggctttttagctacgattatt
gttcctgaagggggaaccgctggggtcggtcaaacgatcgccctcattgccgaaacagaa
gcggaaattgaggaggcgaaaaaacaagccaccaccaccgctaccaccagcaccactacc
ccaccaccaaaagctacccctaccccctctgtagcgaccccagaaccagtggcggcgacg
gttgcgatagagaatacgcctagccgtcgtaatggtcgcattgtggcttctcctcgcgct
cgcaaattggcgaaacaacttaatgtagacttaaataatctccagggtactggcccccac
ggtcgcattgtggcggaggatgtggaagtggctacgggaagggctcagactcctacggtt
gcgcctcaacctactgtttcccctgttgcgactccatcacctatttctaccattcctacc
cccgcaccagccccggttcccttgggagaggttgtggcgatgaatactctacaaaatgcg
gtagtccgcaatatgttggtgagtttgcaggttcctactttccatgtgggctacactatc
actaccgacaacttggataaactctataagcaggttaagtccaagggtgtgacgatgacg
gctttgctggctaaggctgtggcgatcgctatacagaaatatcctattgtcaatgccagt
tatgtggactctggtattcagtacaataaaggcattaatattgctgtagcagtagccatg
ccggacggggggttaattactcccgtactctccaatgctgatcagattgatatttattcc
ctctctcgcacttggaaagatttagtcgcccgcgcccgcagcaaacaattacaaccccaa
gaatacagcagcggaacttttactctctctaacttggggatgtttggggtcgatcgcttt
gatgctattttgcctcccggtcagggctcaattttggcgatcggtgcctctcgtcccacc
gtggtcgccaccgatgatggcatgatgggaattaaacggcaaatgcaggttaacattact
tgcgatcaccgtatcatctacggcgcagatgccgcagctttcctgcaatatctcgcccaa
ctgattgaaactaaccctcaatcattaaccctgtag

DBGET integrated database retrieval system