KEGG   Arthrospira platensis: NIES39_B00640
Entry
NIES39_B00640     CDS       T02608                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
arp  Arthrospira platensis
Pathway
arp00010  Glycolysis / Gluconeogenesis
arp00020  Citrate cycle (TCA cycle)
arp00620  Pyruvate metabolism
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01120  Microbial metabolism in diverse environments
arp01200  Carbon metabolism
Module
arp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES39_B00640
   00020 Citrate cycle (TCA cycle)
    NIES39_B00640
   00620 Pyruvate metabolism
    NIES39_B00640
Enzymes [BR:arp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES39_B00640
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: BAI88821
UniProt: D5A161
LinkDB
Position
complement(962662..963957)
AA seq 431 aa
MIHEVFMPALSSTMTEGKIVSWQKSPGDRVGKGETVLIVESDKADMDVEAFYEGFLATII
VPEGGTAGVGQTIALIAETEAEIEEAKKQATTTATTSTTTPPPKATPTPSVATPEPVAAT
VAIENTPSRRNGRIVASPRARKLAKQLNVDLNNLQGTGPHGRIVAEDVEVATGRAQTPTV
APQPTVSPVATPSPISTIPTPAPAPVPLGEVVAMNTLQNAVVRNMLVSLQVPTFHVGYTI
TTDNLDKLYKQVKSKGVTMTALLAKAVAIAIQKYPIVNASYVDSGIQYNKGINIAVAVAM
PDGGLITPVLSNADQIDIYSLSRTWKDLVARARSKQLQPQEYSSGTFTLSNLGMFGVDRF
DAILPPGQGSILAIGASRPTVVATDDGMMGIKRQMQVNITCDHRIIYGADAAAFLQYLAQ
LIETNPQSLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgattcacgaagtgtttatgcccgccctcagttcgactatgacagagggtaaaattgta
tcgtggcaaaaatccccaggcgatcgcgtcgggaaaggggaaaccgtcctgattgtagaa
tccgataaggctgatatggacgtagaagccttttatgaaggctttttagctacgattatt
gttcctgaagggggaaccgctggggtcggtcaaacgatcgccctcattgccgaaacagaa
gcggaaattgaggaggcgaaaaaacaagccaccaccaccgctaccaccagcaccactacc
ccaccaccaaaagctacccctaccccctctgtagcgaccccagaaccagtggcggcgacg
gttgcgatagagaatacgcctagccgtcgtaatggtcgcattgtggcttctcctcgcgct
cgcaaattggcgaaacaacttaatgtagacttaaataatctccagggtactggcccccac
ggtcgcattgtggcggaggatgtggaagtggctacgggaagggctcagactcctacggtt
gcgcctcaacctactgtttcccctgttgcgactccatcacctatttctaccattcctacc
cccgcaccagccccggttcccttgggagaggttgtggcgatgaatactctacaaaatgcg
gtagtccgcaatatgttggtgagtttgcaggttcctactttccatgtgggctacactatc
actaccgacaacttggataaactctataagcaggttaagtccaagggtgtgacgatgacg
gctttgctggctaaggctgtggcgatcgctatacagaaatatcctattgtcaatgccagt
tatgtggactctggtattcagtacaataaaggcattaatattgctgtagcagtagccatg
ccggacggggggttaattactcccgtactctccaatgctgatcagattgatatttattcc
ctctctcgcacttggaaagatttagtcgcccgcgcccgcagcaaacaattacaaccccaa
gaatacagcagcggaacttttactctctctaacttggggatgtttggggtcgatcgcttt
gatgctattttgcctcccggtcagggctcaattttggcgatcggtgcctctcgtcccacc
gtggtcgccaccgatgatggcatgatgggaattaaacggcaaatgcaggttaacattact
tgcgatcaccgtatcatctacggcgcagatgccgcagctttcctgcaatatctcgcccaa
ctgattgaaactaaccctcaatcattaaccctgtag

DBGET integrated database retrieval system