KEGG   Aeromonas rivipollensis: C7N77_13540Help
Entry
C7N77_13540       CDS       T05453                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
arv  Aeromonas rivipollensis
Pathway
arv00473  D-Alanine metabolism
arv00550  Peptidoglycan biosynthesis
arv01100  Metabolic pathways
arv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C7N77_13540
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7N77_13540
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C7N77_13540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
    C7N77_13540
Enzymes [BR:arv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C7N77_13540
Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
 Precursor biosynthesis
  Amino acid ligase
   C7N77_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AVP94098
UniProt: A0A2P1PGY8
LinkDB All DBs
Position
2926050..2927036
Genome map
AA seq 328 aa AA seqDB search
MKNMHVLLLCGGGGAEHEVSLRSANFLEQQLGLLPGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQGDEALAEARAALAKWGKVFIKAASQGSSVGCYSASNEAELV
QGIKDAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALKAEGLTQAQSDAIHAYSLKAFRQLKLTHLSRIDFFLTEDGEILLNEINTFPGM
TSISMFPKLLEHHGHSFARFLEQNLRPV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggcggtggcgccgagcacgaagtctct
ctgcgcagtgccaatttcctcgaacaacagctcggtctcctgcctggggtcgaagtgacc
cgggtcgagatgttcgccgaccgctggctcagtgccgacggccgcgagtgcaagctgggg
ctggacaagctgctctcctttgacagtgtggcccgtccggtggactacgtggtgccctgc
atccacggctatccgggtgagaccggcgatctgcaatccttcctcgagctggcgggcctg
ccctatctggggtgcgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctccgccatcggcatccccaataccccctatctgtttttgaccgagcagggt
gacgaggcactcgccgaggcgagagccgcgctggccaagtggggcaaggtatttatcaag
gccgcctcgcaagggtcatccgtaggctgctactccgccagcaacgaggccgagctggtg
caggggatcaaggatgccttcggttactccgagcaggtgctgatagagaaggcggtcaag
ccccgcgagctggaagtagcggtttaccagtatggcgacgagctggtggccacctatccc
ggggagatctgcgtgccccaggacaagttctacacctatgaagagaagtacagcagcgcc
agccacaccgagacggcgctcaaggcagaaggcttgacccaggctcagtctgacgccatc
catgcctactccctcaaggccttccgtcagctgaagttgacccatctgtcgcgtatcgac
ttcttcctgaccgaggatggcgagatactgctcaacgagatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcacagcttcgctcgcttc
ctcgagcagaatctgcgccccgtctga

DBGET integrated database retrieval system