KEGG   Aeromonas rivipollensis: C7N77_19640Help
Entry
C7N77_19640       CDS       T05453                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
arv  Aeromonas rivipollensis
Pathway
arv00550  Peptidoglycan biosynthesis
arv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:arv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C7N77_19640 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C7N77_19640 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
    C7N77_19640 (mrdA)
Enzymes [BR:arv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C7N77_19640 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:arv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C7N77_19640 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MtrB
Motif
Other DBs
NCBI-ProteinID: AVP95166
UniProt: A0A2P1PK14
LinkDB All DBs
Position
4252050..4253978
Genome map
AA seq 642 aa AA seqDB search
MLKNRIEMRDHSAEGRLFFRRTLVAYIGMVVLMLVLLGNLYYLQVESYETYQTRSNDNRI
RVVPVAPPRGLIYDANGVLLAENRPVYSLEIVPEETEDLEKTADELITLLALPEGTKERF
LAEVKRQRRFKPVPLFEKLTEYQVALFSVNQHNYPGASIEAYLKRYYPFGDTLTHALGYV
AKINTRDVERLDKEDKLANYAATKDIGKQGVEKFYEDQLHGVAGYQEVEVNNRGRVVRTL
KFQPPEPGKDIYLNIDIRLQLKAQELLAGRRGAIVMMDPNTGAILAMESSPSYDPNLFVT
GISNTNYSALLNDPARPLVNRTTQGIYAPASTVKPMMAVMGLNEGAITPNYRYFGGPSFS
IPGTTKKFRDWRRWGHGWLDVYRAIEVSADTYFYDLAYRVGIDKIHAYMTKFGFGQYSGV
DLYEETKGVMPSRDWKMARWRQPWYQGDTISIGIGQGYWSSTPIQLAKAISILTQNGHDV
TPHLLKSTASVDGVVNAPINPNVAIAAKSDTYWQVAKDGMWRVINGHEGTGRRAFAGTPY
KAAGKSGTAQVVGLKENQVYNAATTKVEHRDNALFVAFAPFEAPKAVVALVLENAGGGSA
MGAPVARHMLDAYLLPPEPQLPPAPDKPSTPGPDQREAVPNE
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaatcgcatcgaaatgcgcgatcacagtgccgagggacgtctgttcttccgg
cgcaccctggtagcctacatcggcatggtcgtcctcatgctggtgctgctgggtaatctc
tactacctgcaggtagagtcttacgaaacctatcagacccgttccaacgacaaccggatc
cgggtcgtgccggtggcaccgccgcggggcctcatctatgacgccaacggcgtgctgctg
gcggagaaccgccccgtctacagcctggagatagtgccggaggagaccgaggatctggag
aagaccgccgacgagctgatcaccctgctggccctgccggaggggaccaaggagcggttc
ctggccgaggtgaaacgccagcgccgcttcaagccggtgcccctgttcgagaagctgacc
gagtaccaggtcgcgctcttctcggtcaaccagcacaactacccgggcgccagcatagag
gcctatctcaagcgctactatccctttggtgacaccctgacccatgcgctgggctatgtg
gccaagatcaacacccgtgacgtggagcgcctcgacaaggaggacaagctcgccaactat
gccgccaccaaggacatcggcaagcagggggtggagaagttctacgaggatcagctgcac
ggcgtggcgggctaccaggaggtcgaggtcaacaaccgcggccgggtggtgcgcaccctc
aagttccagccgccggagccgggcaaggatatctatctcaacatcgacatccgcctgcag
ttgaaggcgcaggagctgctggccggccgccggggcgccatcgtcatgatggatcccaat
accggcgccatcctggccatggagtcgagcccgagctacgaccccaacctgttcgtgacc
ggcatctccaacaccaattactcggcgctgctcaacgatccggcgcgcccgctggtgaac
cgcaccacccagggcatctatgcccccgcctccaccgtcaagcccatgatggcggtgatg
gggctgaacgagggggccatcacccccaactatcgctacttcggcggtcccagcttctcc
atcccgggcaccaccaagaagtttcgtgactggcgccgctggggccatggctggctcgac
gtctatcgcgccatcgaggtgtcggcggacacctacttctacgatctcgcctaccgggtc
ggcatcgacaagatccacgcctacatgaccaagttcggcttcggtcagtacagtggcgtc
gacctctatgaagagaccaagggggtcatgccgtcccgcgactggaagatggcgcgctgg
cgtcaaccctggtatcagggggacaccatctccatcggcataggccagggctactggagc
tccacccccattcagctcgccaaggcgatcagcatactgacccagaacggtcacgacgtg
acgccgcacctgctcaagagcaccgcctcggtggatggcgtggtcaacgcccccatcaac
ccgaacgtggccatcgccgccaagagcgacacctactggcaggtggccaaggatggcatg
tggcgcgtcatcaacggccatgaggggacggggcgccgcgcctttgcgggcactccctac
aaggcggcgggcaagtcaggtaccgcccaggtggtgggcctcaaggagaaccaggtctac
aacgcggccaccaccaaggtggagcaccgcgacaacgccctcttcgtcgccttcgcgccg
ttcgaggcccccaaggccgtggtggccctggtgctggaaaacgccggtggcggcagtgcc
atgggggcgccggtcgcccgccacatgctggatgcctacctgctgccgccagagccccag
ctgccgccggcgcccgacaagccgtccacccctggcccggatcagcgcgaggctgtgccc
aatgaataa

DBGET integrated database retrieval system