KEGG   Arthrobacter alpinus A3: MB46_07150Help
Entry
MB46_07150        CDS       T04228                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
arw  Arthrobacter alpinus A3
Brite
KEGG Orthology (KO) [BR:arw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MB46_07150
Enzymes [BR:arw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MB46_07150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ALV45305
UniProt: A0A0U3FQ00
LinkDB All DBs
Position
1641102..1642319
Genome map
AA seq 405 aa AA seqDB search
MTNTYGNSRRAPKLATAAALVAVSGLLLGGCSSPSSENGAIDAGSSAAPVTVVVSRPAAP
EGELPEALQAELQAALKSVMATYHVPGAAAGVWVPGEGSWTTAAGLADVDGGIPVTTDMV
WPIRSITKSYTVSLILQLADEGKLGLDDTIDKYVDGVTDGDQITLLELANMSSGNADYVN
EAFLVKWQADPAKIFTLDELNRGALGQPAEFEPGTKYVYTNANINLLGAVIEKVTGEAYV
DVLQERILDPLEQTGTSYMVDASKWAEPHPVGYVIEDGVAEAREENSSILGPAGSMFSTL
DDGRVWAEALGSGALLKPATQKLREIGHKIAKPPYDLYAVGMGTTNGWWGHNGEGVGFTA
ATFYDSKTGASIVVYMNESDTADKSHPADEAFRALAAVLENGASK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatacatacggcaattcacgccgggctccgaagcttgccacggcagcggcgctc
gtcgcggtgagtggcctgctgctcggcggatgctcctcgccatcctccgagaatggagcg
atcgatgctggtagctccgcggcgccggtcacagtagtggtctctcgccctgcggctccc
gaaggtgaactccccgaggcgctccaagccgagctccaagccgcactcaagtcggtcatg
gccacgtaccacgtgcccggagcagccgctggagtctgggtgccgggcgaaggttcgtgg
acaacggctgccggactcgccgacgtcgacggaggtatccccgtaacgaccgacatggtg
tggcccatccgcagcatcacgaagtcatacaccgtcagcctgattcttcagctcgcagac
gagggcaagctgggccttgacgacacgatcgacaagtatgttgacggcgtcaccgatggc
gaccagattacgttgctcgaactggcgaacatgtctagcggcaatgccgactacgtcaat
gaggcgttcctcgtgaagtggcaggccgatcccgcgaagatcttcacacttgacgaacta
aaccgcggggcgctcggacaaccggctgaatttgagcccggcacgaagtacgtctacacc
aacgccaacatcaacctgctcggtgccgtgatcgagaaagtgaccggtgaggcgtatgtt
gatgtgctgcaagagcgcatcctcgacccgctcgaacaaaccggcacgagctacatggtc
gatgcctctaaatgggccgaaccacacccagtggggtacgtcatcgaagacggggttgcc
gaggcgagagaggaaaactcctcgatcctgggcccagccgggtcgatgttctcaacactc
gacgacggccgcgtgtgggcagaggctcttggctctggtgcgctgctcaagccagcgaca
cagaaactgcgcgagattggccacaagatcgccaaaccgccctacgacctctacgccgtg
gggatgggaaccaccaatggatggtggggtcacaacggggaaggcgtgggattcactgcc
gcgacgttctacgacagcaaaacaggagcaagcatcgtggtgtacatgaacgaatctgac
accgcagacaaatcgcacccagccgatgaggccttccgagccctcgccgccgtgctcgag
aacggagcgagcaagtga

DBGET integrated database retrieval system