KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_2628Help
Entry
ASA_2628          CDS       T00500                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASA_2628 (ahpF)
Enzymes [BR:asa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ASA_2628 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABO90652
UniProt: A4SP30
LinkDB All DBs
Position
2808862..2810454
Genome map
AA seq 530 aa AA seqDB search
MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAREISEMSPKIAMTDGSNARK
PSMSVAPQGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKTDPAVLEQIKQLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYMNGQPFS
QGRISLEEIIAKLDTGAADRKAAELSEKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVE
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLGVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNAAPEAAETSAKADAVTA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacagctgaacacctatctgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaacgacagtgacaaatccgcagaactgctggcattggcc
cgcgagatcagcgagatgtcccccaaaattgctatgactgatggcagtaatgcccgcaag
ccttccatgagcgttgcaccacagggccaagccccgcgcgttcattttgccggcatcccc
atgggtcatgaatttacctctctggtgctcgccttgctgcaaagcggcggccacccttcc
aagacagatccggccgtactggagcagatcaagcagctgaagggcgagtttcacttcgag
acctatatctccctctcctgccacaactgcccggacgtggtacaggcgctgaacctgatg
gcgaccctgaatcccggtatcacccacaccatgatcgacggagccctgttccaggacgaa
gtgaacgagcgccagatcatggcggtgccgaacgtctacatgaacggtcagccgttcagc
cagggccgtatctcgctggaagagatcattgccaagctcgataccggtgcggccgatcgc
aaggccgccgaactgagcgaaaaagccccctatgacgtgctggtagtgggtggtggcccg
gctggtgccgcagcagccatctatgccgcccgtaaaggcattcgtaccgccatcgtcgca
gagcgttttggtggtcaggtgatggacacggtcgggatcgagaacttcatctccgtgccc
tacaccgaaggtcccaagctggccgcaagcctggagcagcacgtcaagcagtacggtgtg
gaagtgatcaccgagcagcgtgccgccgccatcagcaaggacggctatgtgaatgtggag
ctggcctctggtgccaccctcaagagtcgcgccgtgatcctggcgaccggtgcccgctgg
cgtgacctgaacgtgccgggcgagctcgagtaccgcaccaagggcgtggcctactgcccc
cactgcgacggtcccttcttcaagggcaagcgcgtggcagtgatcggtggtggtaactcc
ggtatcgaagcagccatcgatctcgccggcatcgtcgagcacgtcacagtggtggaattt
gccgataccctgcgcgccgacgaagtgctgcagaagaaagcccgctccatgggcaacatc
gacatcatcatgagcgcccgcaccacggaagtgatcggtgatggcagcaaggtggtgggg
atggattatgaagatcgcaccacgggtgaaatcaagcacttaggcgtggccggcatcttc
gtccagatcggactggtgccgaacaccgagttcctcaaggggagcgaagtggcactgacc
cgcttcggcgagatcgagatcgacaccaagggcgccacttccctgcccggtgtctatgct
gccggtgacgccactacagtgccgttcaagcagatcatcatctccatgggagccggtgca
accgcagcgctgggggcatttgattacctcatccgcaatgcggcgccagaggcggcagaa
acatccgccaaagccgatgccgtgaccgcctga

DBGET integrated database retrieval system