KEGG   Actinoplanes sp. SE50/110: ACPL_3667
Entry
ACPL_3667         CDS       T02044                                 

Gene name
acbV
Definition
(GenBank) dTDP-4-keto-6-deoxy-glucose 4-aminotransferase
  KO
K20428  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00525  Acarbose and validamycin biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ACPL_3667 (acbV)
Enzymes [BR:ase01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     ACPL_3667 (acbV)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: AEV84562
UniProt: G8SLU8
LinkDB
Position
4060516..4061811
AA seq 431 aa
MSRQADLLARESRHLAPGASEEAALGRRVFVEGRGATLRDADGVEYLDFAAGTLTQSLGH
CHPEVVARLTEQAGKLWNVHDFATADRAALCELLAELLPDHLTTLAFFSTGAEVVEAALR
TVQAVAEPGRNRVGALRHGFHGKTMGARMLVHWDVGDQSFAGNSVLGYAPYCYRCPLELS
YPSCEVRCATLVRRHIAEKPNVSALFFEPVLGAAGVIVPPPGYWEQIAAACRDNGVLLVA
DEVLTGGGRTGTFLASEAIGVAPDLVTLAKGTASGFPFAVLAGRDEVLRHPRAGLAGSTA
STYAGNPLGIAAAHATLSVISRDRLIEQVRDLGAVLADRLAEMHDRHPHLGDVRGIGLLH
GLEFVHDRQSRRPAPEIARRVYTTALDAGLRTAIGGHIIRLAPPFVIDETELLRGLDLLD
RAITEAGRVTA
NT seq 1296 nt   +upstreamnt  +downstreamnt
gtgagcaggcaggccgacctgctcgcccgggagtcgcgtcacctggctccgggagcctcc
gaagaggcggcgctcggccggcgggtgttcgtcgagggccgcggcgcgaccctgcgcgac
gccgacggtgtggaatacctcgacttcgccgccggtactttgacccagtcactcgggcac
tgccaccccgaggtggtggcccggctcaccgaacaggccgggaagctgtggaacgtccac
gacttcgcgaccgccgaccgcgccgcgctctgcgaactgctcgccgaactgctgcccgac
cacctcaccacgctcgccttcttctcgaccggcgccgaggtggtggaggcggcactgcgg
acggtccaggccgtcgccgaacccggccgcaaccgggtcggggcactgcggcacggcttc
cacggcaagacgatgggcgcccgcatgctggtgcactgggacgtgggggaccagtcgttc
gccggcaacagcgtgctggggtacgccccgtactgctaccggtgcccgctggagctgagc
tatccgtcgtgcgaggtccgatgcgccaccctggtacgccggcacatcgccgagaaaccc
aacgtgagcgccctgttcttcgaaccggtgctgggcgcggccggcgtgatcgtgccgcca
ccgggctactgggagcagatcgcggccgcgtgccgggacaacggcgtactgctggtcgcc
gacgaggtgctcaccggcggcggccggaccggaacctttctggccagcgaggcgatcggg
gtcgccccggatctggtcacgttggccaagggcaccgcgtccggtttcccgttcgccgtg
ctcgccgggcgtgacgaggtgctgcggcatccccgggccgggctcgccggatcgaccgcc
tccacctacgccggcaacccgctcgggatcgccgccgcccacgccaccctctcggtgatc
tcccgcgaccggctgatcgagcaggtccgggacctcggcgcggtgctggccgaccgcctg
gccgagatgcacgaccggcacccgcacctgggcgacgtgcgcggcatcggcctgctgcac
gggctcgagttcgtgcacgaccggcagagccggcggccggccccggagatcgcccggcgg
gtctacaccaccgccctcgacgccggtctgcgcaccgccatcggcgggcacatcatccgg
ctcgcgccgccgttcgtcatcgacgagaccgagctgctgcgcggcctggacctgctggac
cgggcgattaccgaggccgggcgggtgacggcatga

DBGET integrated database retrieval system