KEGG   Actinoplanes sp. SE50/110: ACPL_3670
Entry
ACPL_3670         CDS       T02044                                 

Gene name
acbR
Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00525  Acarbose and validamycin biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Module
ase_M00814  Acarbose biosynthesis, sedoheptulopyranose-7P => acarbose
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ACPL_3670 (acbR)
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     ACPL_3670 (acbR)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: AEV84565
UniProt: Q27GS1
LinkDB
Position
4065417..4066508
AA seq 363 aa
MSTGVRAVLLAGGEGRRMGALGAGRLKPLVPFGGAARLIDFSLANARDSGLDQVLLLSQY
QERQLMDDLRRTWWQPGFRVHFGPYDRAYTDGIPVEYEPPTGPPERGTADALIRKAPYLF
GPDVTEVLVQHADHVYRFDYRPMIAEHRASGAALTVSYQRIDRRYVHLFGMVEFDDRNRL
VSFVEKPAEPTSDLVFAAFCVFDAAVLHRYLELLDGTDWQHDISRDVIPAMLAAGEHIRG
CPVPGYWADIGTVERYHEAHLSLVGTPPSLAVDAMPWTVAPRTARALVTSADGVRHSVVP
ADLVNHGTVERSVLFPAARIGPGATVRDSVLLPGAVVPAGAEIDGAVVLEDGTVQQVTTG
ARR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgagcacgggcgtacgggcggtgctgctcgccggtggtgagggacggcggatgggagcg
ctcggcgcgggccggctcaagccgctggtgccgttcgggggcgcggcccggctgatcgac
ttcagtctggccaatgcccgcgactccggcctggaccaggtgctgctgctgtcgcagtac
caggagcggcagctgatggacgacctgcggcgcacctggtggcagccggggttccgggtg
cacttcgggccgtacgaccgggcctacaccgacgggatcccggtggagtacgagccgccg
accgggccaccggagcggggcaccgcggacgcgctgatccgcaaggccccctacctgttc
gggccggatgtcaccgaggtgctggtgcagcacgccgatcacgtgtaccgcttcgactac
cggccgatgatcgccgagcaccgcgcgtccggtgccgcgttgaccgtgtcctaccagcgg
atcgaccgccggtacgtgcacctgttcgggatggtcgagttcgacgaccgtaaccgtctg
gtctcgttcgtggagaagcccgccgaaccgaccagcgacctggtgttcgccgcgttctgc
gtgttcgacgccgcggtgctgcaccgctacctggaactgctggacggcaccgactggcag
cacgacatcagccgcgacgtcatcccggcgatgctggccgccggcgagcacatccgcggc
tgcccggtgcccggctactgggccgacatcggcaccgtcgagcgctatcacgaggcccac
ctgtcgctggtgggcacaccgccgtcgctggccgtcgacgccatgccgtggaccgtggcg
ccccggaccgcccgggcactggtgacctcggccgacggtgtgcggcacagtgtcgtaccg
gcggacctggtcaaccacggcaccgtcgagcgcagcgtgctcttcccggcggcgcggatc
gggcccggcgcgacggtgcgcgacagtgtgctgctgcccggagcggtggtgccggccggc
gcggagatcgacggcgccgtggtgctcgaggacggcaccgtccagcaggtcaccaccgga
gcccggcgatga

DBGET integrated database retrieval system