KEGG   Alligator sinensis (Chinese alligator): 102375419
Entry
102375419         CDS       T02922                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00220  Arginine biosynthesis
asn00330  Arginine and proline metabolism
asn01100  Metabolic pathways
asn04020  Calcium signaling pathway
asn04146  Peroxisome
asn04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102375419 (NOS2)
   00330 Arginine and proline metabolism
    102375419 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102375419 (NOS2)
   04020 Calcium signaling pathway
    102375419 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102375419 (NOS2)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102375419 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102375419
NCBI-ProteinID: XP_025066417
UniProt: A0A3Q0H7L0
LinkDB
Position
Unknown
AA seq 1152 aa
MLCPWQFAFKNQASKNRSFEEKDVNNNVEKGAMKDHSLMKEDADNLSKKQNEMPCVKTAA
EKPPQNGIKPANQNPRCPRYVKIKNMENGSILQDTLHLQAKEVMNCRTKACQGALMTPKG
FMRGPRDKPVPPEELLPQAIEFVNQYYGSFKEPKVEEHLARMEAVNKEIETTGTYQLTKD
ELIFATKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHIEYSTNNGNIRSAI
TVFPQRTDGKHDFRIWNGQLIRYAGYQMPDGSIIGDPGCVQLTQLCIDLGWKPKYGRFDL
VPLIIQANGQDPEIFELPPEIILEVPMEHPKYEWFKDLDLKWYAMPAVANMLLEVGGLEF
TGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLDTNKLSSLWKDQAVIEINIAVLY
SFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWLVPPISGSITPVFHQEMLNYV
LSPFYYYQEDAWKTHVWHDETRRPKKKEIKFSVFAKAAFFASSLMRKTMAARSKATVIYA
TETGKSETLANNLRDLFNCAFNTRILCMDDYKISDLEKENLLLVVTSTFGNGDSPGNGKK
LKDSLFAMKKLNKKLRYAVFGLGSTMYPEFCAFAHAIDQKLTQLGASQITATGEGDELNG
QEEAFRAWAVNAFKTACEIFDVRGKNSIQVPKMYTADESWNPKNYRVVYDSQALDLSKGL
ADIHAKNVIPMKLKFRQNLQSSKSSRVTILVKLSCESNQEMQYLPGDHVGIFPGNQPELV
QDITELLKDAPPADQTVRLETYNDGGYWTSDKKIPPCTLSEALTYFLDITTPPSQQLLKK
LSQLATEEGDKQRLEVLCHSLEKYNDWKFFNSPTILEVLKEFPSIKVSTPFLLTQLPLLK
PRYYSISSSQDMSPREVHLTVAVVNYRTKDGQGPLHHGVCSTWLNTINLSESVPCFVRSA
AGFQLPKDPSTPCILIGPGTGIAPFRSFWQQRLHDLEKKGIKGSGMTLLFGCRRSDTDHI
YREETQEMKRMGVLKEVYTAYSRQPGQAKVYVQDILRSKLEAEVHQVIHEDKGHLYVCGD
VRMARDVAQTLREMFAKRLKLTEEQAEEYVSQLKSQKRYHEDIFGAVFPRNHKRDGKASK
PTSQRTDQQLTF
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgctgtgcccttggcaatttgcattcaagaatcaagccagtaagaaccggtcctttgaa
gagaaagatgtaaataataatgtggaaaaaggagccatgaaagatcacagcttaatgaaa
gaagatgccgataacctgagcaagaaacagaatgagatgccgtgtgtcaaaactgcagcc
gagaaacctccacaaaatggcatcaagccagcgaaccaaaatccgaggtgtccaagatat
gtaaaaataaaaaacatggaaaatggcagcatccttcaagatacattgcaccttcaggca
aaggaggttatgaactgcaggaccaaggcttgccaaggggcactgatgaccccaaaaggt
tttatgagaggccctagggacaagccagtcccaccagaggaacttctacctcaggcgata
gaatttgtcaatcagtactacggctcgttcaaagaaccaaaagtagaagaacatctggcc
cgaatggaagcagttaataaagagatagaaacaacaggaacctatcaactgaccaaagat
gaacttatctttgcgaccaaacaggcctggagaaatgctccaagatgcataggaagaatc
cagtggtccaatctacaggtgttcgatgcacgtgactgtaaaacagccaaggaaatgttt
gaacatatctgtcgccacattgaatactccacaaacaatggaaatataaggtcggccatc
actgtcttccctcaacggactgatgggaaacatgattttcgcatatggaatggccagctc
atccgatacgctgggtaccaaatgccagatgggtccatcatcggagacccaggctgtgtg
cagctgacacagttgtgcattgatcttgggtggaagcccaagtacggtcgctttgattta
gttccactgattatccaagcaaacggccaagacccggaaatatttgaactgcctccagaa
attatccttgaagtgccaatggagcatccaaagtacgaatggtttaaagacctggatctg
aagtggtatgcgatgcctgctgtggccaacatgttgctcgaagtgggaggcctggaattc
actggctgccctttcaacggctggtacatgggcaccgagataggcgtgcgagatttctgt
gatgtgcaacggtacaacatccttaaggaagtaggaagaaggatgggtctggacacaaac
aaactttcttcactgtggaaagatcaagctgttatagagattaacatcgctgtgctttat
agcttccaaaagcaaaatgtcaccatcatggatcaccactctgctgctgagtccttcatg
aaatacatgcagaatgagtaccgtgttcgaggaggttgtccggcagactgggtttggctt
gtgcctccgatatcagggagcattaccccagtatttcaccaggagatgctgaactatgtg
ctttcaccattctattactaccaggaggatgcttggaaaactcatgtctggcatgatgaa
acacgcaggccaaagaaaaaggagataaagtttagtgtttttgcaaaggccgcattcttt
gcctcttcactgatgcggaaaacgatggcagccaggtctaaagcaactgtgatatatgcg
acagagacagggaaatctgaaaccctggccaacaatctgcgtgacttattcaactgtgcc
ttcaataccaggattctttgtatggatgactataagatcagtgacctggagaaagaaaat
ctccttctggtggtgaccagcacttttggaaatggagattcacctggcaatggaaagaaa
ctgaaggattccctgttcgctatgaaaaagctgaacaaaaaactcagatatgctgtattt
ggcctgggatcaaccatgtatccagagttctgtgccttcgctcatgccattgaccaaaaa
ctcacacagctaggtgcctctcagatcaccgcaacaggtgaaggggatgaactcaatggg
caggaagaagcctttcgtgcctgggcagtgaatgcattcaagactgcctgtgagatcttt
gatgtccgtgggaaaaacagcattcaggtacccaagatgtataccgctgatgagtcctgg
aatcctaagaactacagggtggtgtatgactcccaggctttggacttgagtaaaggactt
gctgacatacatgcaaagaatgtgattccaatgaagctcaaatttaggcagaacctgcaa
agttcaaaatccagtcgtgttaccatccttgttaagctttcctgtgagtctaatcaggaa
atgcagtacctgcccggagatcacgttgggattttcccaggcaaccagccagaattagtt
caggacatcactgagcttcttaaagatgcacccccagctgatcagactgtccgactggaa
acctacaatgatggtggctactggacaagtgacaagaaaattccaccctgcacactctca
gaagccttgacatacttcctggatatcaccaccccaccctcacagcagctgctaaaaaag
ctctcccagctggcaacagaggaaggagacaaacagagactggaagtcttatgtcatagc
ttagagaagtacaacgactggaagtttttcaacagtcccaccatcctggaggtcctgaag
gaattcccttccattaaggtctcaacacctttcttgctgactcagttgcctttgctgaag
cccaggtactactccatcagctcctcacaagacatgtcacccagagaggtccatctgaca
gttgcagtggtcaactacaggacaaaggatggtcaaggtcccttacatcatggagtttgc
agtacatggctgaatacaataaatctcagtgaatcagtgccatgctttgtacgcagtgct
gccggattccagctcccgaaggatccatccacgccatgcattctgattggcccagggaca
ggaattgctccattcagaagcttctggcagcagcgtctccatgacttggaaaagaaagga
atcaaaggcagcggcatgacattactgttcggctgccgacgatcagatacggatcacatc
tacagagaagaaactcaggagatgaagagaatgggagtactcaaagaggtctacactgct
tactccaggcagcctggccaagcaaaagtctatgttcaagacattcttcggagcaagctg
gaggcagaagtgcaccaagtcattcatgaagacaaagggcatctgtatgtctgtggagat
gtgcgcatggccagggacgttgcccagaccttgagggagatgtttgctaagagactgaag
ctgacagaggagcaggctgaagaatacgtctcccagctcaagagccagaagcgataccat
gaagacatatttggggctgtgtttccacgtaaccacaaacgagatggaaaagcttcaaaa
cccaccagccaaagaacagatcagcagttaacattttaa

DBGET integrated database retrieval system