KEGG   Alligator sinensis (Chinese alligator): 102386481Help
Entry
102386481         CDS       T02922                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00590  Arachidonic acid metabolism
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102386481 (PTGS1)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102386481 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 102386481
NCBI-ProteinID: XP_006016955
UniProt: A0A1U7R452
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MAKPSLPVSLAMMLSVCLAVGSPSTVDPCCYFPCQHQGVCVQVGLEGYECDCTRTGYFGT
NCTLPEFWTRIHKLLKPSPAFYHFVLTHFKWFWDIINSTFIRDTLMTLVLKIRANLIPSP
PTYNSDYGYISWESYANVSYFTRVLPPVPGDCPTPMGTKGKKELPDPQLLAERFLLRRTF
EKDPQGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDTLERQHQLRLF
RDGKLKYQVVDGEVYPPTVLQAPVHMIYPNGTAQAQQLAVGQEVFGLLPGLMMYATLWLR
EHNRVCDVLKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLRLKFDPELLF
GVQFQYRNRIAVEFNQLYHWHALMPDAFVIQGQEYSYQQFIYNTTMLTDYGIEELVEAFS
KQHAGRIGGGQSINGNLLNVAVGLIKESRQLRLQPFNEYRKRFGMRPYASFQELTGEEEK
AAQLAELYGDIDALEFYPGLLLEKPQANAIFGESMVEIGAPFSLKGLLGNPICSPVYWKP
STFGGATGFALVQTASLQKLVCNNVRRCPYVSFRVPDPGPEPAEHSAAQPSTEL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccgagtctccccgtctcgctggcgatgatgctgagcgtgtgcctggccgtg
gggagccccagcacagtggatccctgctgctacttcccctgccagcaccaaggcgtgtgc
gtgcaggtcggcctggagggctacgagtgtgactgcacgcggaccgggtacttcgggacc
aactgcaccctgcccgagttctggacgcgcatccacaagctgctgaagcccagcccggct
ttctaccacttcgtgctgacccacttcaagtggttctgggacatcatcaacagcaccttc
atcagggacacgctgatgacgctggtgctgaaaatccgggccaacctgatccccagcccc
cccacctacaactcggactacggctacatcagctgggagagctacgccaacgtgagctac
ttcacccgcgtcctgccgccggtgcccggtgactgcccgacgcccatggggaccaaaggg
aagaaggagcttcccgacccccagctcctggccgagaggttcctgctccgacggacgttt
gagaaggacccgcaaggcaccaacctgatgttcgccttcttcgcccagcacttcactcac
cagttcttcaagacatccgggaagatgggacgcggcttcaccaaggctctgggccatggg
gtggatctcgggcacttgtacggggacaccctggagcgtcagcaccagctgcggctcttc
agagacgggaagctcaagtaccaggtggtggacggggaggtgtacccgcccacggtgctc
caggcgccggtgcacatgatctaccccaacggcaccgcccaggcccagcagctggccgtg
ggccaggaggtgtttgggctcctgcccgggctgatgatgtacgcgaccctctggctccgc
gagcacaaccgcgtctgtgacgtgctgaagcaggagcacccgacgtggggcgacgagcag
ctcttccagacggcccggctcatcctcatcggggagaccatcaagatcgtcatcgaggac
tacgtgcagcacctgagcgggtacttcctgcgcctgaagttcgaccccgagctgctgttc
ggggtgcagttccagtaccgcaaccgcatcgccgtggagttcaaccagctctaccactgg
cacgcgctcatgccggacgccttcgtcatccaggggcaggagtacagctaccagcagttc
atctacaacaccaccatgctcacggactacggcatcgaggagctggtcgaggctttctcc
aagcagcacgccggacggatcggcgggggacagtccatcaacggcaacctcctgaacgta
gccgtcgggctcatcaaggagtcccggcagctgcggctgcagcccttcaatgagtaccgc
aagaggtttggcatgaggccctacgcatccttccaggagctgacaggagaggaggagaag
gcggcgcagctggcggagctgtacggcgacatcgacgccctggagttctacccggggctg
ctgctggagaagccgcaagccaacgccatctttggggagagcatggtggagatcggggcc
cccttctccctcaaggggctgctggggaaccccatctgctcccccgtgtactggaagccc
agcaccttcggcggcgccaccggcttcgcgctggtgcagacagcgtcgctgcagaagctg
gtgtgcaacaacgtgcgacggtgcccgtatgtgtccttccgcgtgccggaccccggcccg
gagccggctgagcacagcgcggcccagccctccacagagctctag

DBGET integrated database retrieval system