KEGG   Acinetobacter soli: BEN76_13750Help
Entry
BEN76_13750       CDS       T04684                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
asol  Acinetobacter soli
Pathway
asol00473  D-Alanine metabolism
asol01100  Metabolic pathways
asol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asol00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BEN76_13750
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BEN76_13750
Enzymes [BR:asol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BEN76_13750
Peptidoglycan biosynthesis and degradation proteins [BR:asol01011]
 Precursor biosynthesis
  Racemase
   BEN76_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APV37019
UniProt: A0A1P8ELD5
LinkDB All DBs
Position
2909961..2911058
Genome map
AA seq 365 aa AA seqDB search
MPRPIHAVVHQDALTHNLQVARNATPDSQVFAVVKANAYGHGIERVYPALSAADGFALLD
LAEAKRIRALGWTGPILLLEGVFSPQDLYDCTQDQLSFTVHHLSQIEWIERHPAPAQFHV
YLKMNSGMNRLGFQPAAYREAWQRLHALPQVASITHMTHFSDADGNRFGESGINYQQRIF
EQTVEGLAGPRSISNSAAILRHPLHSDVVRSGIMLYGSAPDYPAHSIDHWTLKPTMSLRS
ELLAIQDLQPNDTVGYGSSFMADRPLKIGIVACGYADGYQRISPTGTPILVDGVRTRTVG
RVSMDMLAVDLTPVPQAAVGSEVVLWGRSKSGATLSIDEVAVASGTVGYELMCAVTARVP
FIIQT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcccattcatgccgttgtgcatcaggatgccttaacacacaatcttcaggtt
gcccgaaacgccacgccagacagtcaggtctttgccgtggttaaggccaatgcttatggt
catggtatcgaacgcgtatatccggccttaagcgccgccgatggttttgcactacttgat
cttgccgaagccaaacgcattcgggcgttgggctggaccgggccaatattgttactggaa
ggtgtgttttcaccgcaagatttatacgattgcacgcaagatcagctcagctttaccgta
catcacctgagccagattgaatggatcgagcgtcatcctgcgccagcgcagtttcatgtt
tatttaaaaatgaacagcggcatgaaccgtttgggctttcagcctgcggcgtatcgcgaa
gcgtggcagcgcctgcatgcattaccgcaggtggccagtatcacgcacatgacgcacttt
tccgatgcagatggcaatcgttttggcgagtctgggattaactatcagcaacgtattttt
gaacaaacggttgaggggcttgcgggcccacgatcgatcagtaacagtgccgcgattcta
cgccatccattgcactccgatgttgtccgtagcggcatcatgctctatggcagcgcacca
gattatccggcacattcaatcgaccactggacactcaagcccacgatgagcctacgtagt
gagttgctggccattcaagatttacagcccaatgacactgtgggatacggctcaagcttt
atggcagaccgcccactcaagatcggtattgtggcttgtggttatgccgatggttatcaa
cgtatatcgccaacaggtacgcctattctggtagatggcgtgcgtacccgtaccgttggt
cgcgtcagtatggacatgctggcagtcgatttgacgcctgtaccacaggctgctgtcgga
agtgaggtggtgctgtggggtaggtctaaatctggtgcaactttatccatcgatgaggtg
gcagtggcttcgggcaccgtaggttatgaactcatgtgtgctgtgacggcacgcgtacca
tttattatacaaacataa

DBGET integrated database retrieval system