KEGG   Aeromonas schubertii: WL1483_1365Help
Entry
WL1483_1365       CDS       T04186                                 

Gene name
nodI
Definition
(GenBank) ABC transporter-like protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
asr  Aeromonas schubertii
Brite
KEGG Orthology (KO) [BR:asr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asr02000]
    WL1483_1365 (nodI)
Transporters [BR:asr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    WL1483_1365 (nodI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SbcCD_C SMC_N CysG_dimeriser DUF4162 Rad17 AAA_22 AAA_23 AAA_29
Motif
Other DBs
NCBI-ProteinID: ALP40784
UniProt: A0A0S2SGQ0
LinkDB All DBs
Position
3582196..3583125
Genome map
AA seq 309 aa AA seqDB search
MSELAIETRGMSRSFGDLKAVDSLSLAIPRGTIYGFLGPNGCGKSTSIRMLTGLLRPTSG
EIRVLGESLPGAEEPLRRRIGYMTQKFSLYENLTVAENLGFVARIHGLGGREAKARITEL
IALYELGGRERQMAGSMSGGQKQRLALAAATLHRPELLFLDEPTSAVDPENRREFWERLF
DLCAAGTTILVSTHYMDEAERCHALAILERGVKRADGAPQALMAAMGARVIEVAGETLRP
LRQRLTQAPEVLSAAQIGSRLRVLVRSDLPDPLGWLAARVEGRPLAEVRPSLEDVFVTCT
GERGGHHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctggccatcgagacccggggcatgagccgcagcttcggggatctcaaggcg
gtggacagtttgagcctcgccatcccccgcggcaccatctatggctttctcggccccaac
ggctgcggcaagtctacctccatccgcatgctgaccggcctgctgcgccccaccagcggc
gagatccgggtactgggggagtccctgcccggcgccgaggagcccctgcgccggcgcatc
ggttacatgacccagaagttctccctctacgagaacctgacggtggccgagaacctgggc
ttcgtggcccgcattcacggccttggcggacgcgaggcgaaagcgcggatcaccgagctg
atcgccctctatgagctcggcgggcgagagcgccagatggcgggctccatgagcggtggc
cagaagcagcgcctggccctggcggccgccaccctgcacaggcccgagctgctctttctc
gacgagcccacctcggcggtcgatcccgagaatcgccgggagttctgggagcggctgttc
gatctctgcgccgccggcaccaccatactggtctcgacccactacatggacgaggcggag
cgctgccatgccctggccatactggagcgcggcgtcaagcgggccgacggcgccccccag
gcgctgatggcggccatgggggcccgggtcatcgaggtggcaggcgagaccctgcgcccc
ctgcgccaacgcctgacccaggcccccgaggtgctgagcgccgcccagattggaagcagg
ctaagggtgctggtacgcagcgatctccccgaccctctgggctggctggccgctcgggtc
gaggggcggccactggccgaggtgcgccccagcctggaggatgtgtttgtcacctgcacc
ggggagagagggggtcaccatggggcttag

DBGET integrated database retrieval system