KEGG   Arabidopsis thaliana (thale cress): AT1G02300Help
Entry
AT1G02300         CDS       T00041                                 

Definition
(RefSeq) Cysteine proteinases superfamily protein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT1G02300
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT1G02300
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G02300
   00536 Glycosaminoglycan binding proteins [BR:ath00536]
    AT1G02300
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     AT1G02300
Peptidases and inhibitors [BR:ath01002]
 Cysteine peptidases
  Family C1: papain family
   AT1G02300
Chaperones and folding catalysts [BR:ath03110]
 Intramolecular chaperones
  Papain family
   AT1G02300
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   AT1G02300
Glycosaminoglycan binding proteins [BR:ath00536]
 Heparan sulfate / Haparin
  Others
   AT1G02300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1
Motif
Other DBs
NCBI-GeneID: 839576
NCBI-ProteinID: NP_563647
MIPS: AT1G02300.1
TAIR: AT1G02300
Araport: AT1G02300
UniProt: F4HVZ1
LinkDB All DBs
Position
1
AA seq 379 aa AA seqDB search
MADSCCIRLHLLASVFLLLFSSFNLQGIAAENLSKQKLTSLILQNEIVKEVNENPNAGWK
AAFNDRFANATVAEFKRLLGVIQTPKTAYLGVPIVRHDLSLKLPKEFDARTAWSHCTSIR
RILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSDRFCIKYNLNVSLSANDVI
ACCGLLCGFGCNGGFPMGAWLYFKYHGVVTQECDPYFDNTGCSHPGCEPTYPTPKCERKC
VSRNQLWGESKHYGVGAYRINPDPQDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKYITG
TKIGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYFKIRRGTNECGIEQSVVAGLPS
EKNVFKGITTSDDLLVSSV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagttgttgtatcagacttcacttattagcctctgttttcttgctcttattt
tcatccttcaacttgcagggtattgcagcggaaaatctttccaagcagaaactgacctca
ctgattcttcagaatgagattgtaaaggaagtcaatgagaatccaaacgctggttggaaa
gctgctttcaatgatcggtttgcaaatgccaccgttgcagagtttaagcgactcctcggt
gttatacaaacaccaaagacggcatacttaggtgtacctattgtaagacatgatttatcg
ttgaagcttcctaaagaatttgatgctagaaccgcttggtcacattgcaccagtattcga
aggatcttagtgggttatatattgaacaatgtgttactctggtcgacgataactttatgg
ttttggtttcttttgggtcattgtggttcttgctgggcatttggtgctgttgaatcactg
tccgacaggttctgcatcaaatataacttgaatgtttccttatctgccaatgatgtcata
gcatgttgtggattactttgcggttttggttgtaatggtggtttcccaatgggtgcatgg
ttgtactttaagtaccacggtgtagtaacccaagagtgtgatccatactttgacaatact
ggttgctctcacccgggatgtgaacccacttaccctacaccaaaatgtgagaggaaatgt
gtaagcagaaaccagctatggggtgaatcaaaacactatggtgtcggcgcatacagaatc
aatcctgaccctcaagacattatggctgaggtttacaagaatggacctgtcgaggttgct
tttaccgtttacgaggactttgcacattacaaatcaggagtatacaagtacataacgggt
actaagattggaggtcatgcagttaagctcattggctggggaacttctgatgacggcgaa
gattattggttgcttgcaaatcaatggaaccgaagctggggtgatgatggttacttcaag
atcaggagaggaacgaacgaatgtggcattgaacagagtgttgtagctggtttaccttca
gagaagaacgtatttaaaggtattaccacttcagatgatcttctggtttcctcagtctaa

DBGET integrated database retrieval system