KEGG   Arabidopsis thaliana (thale cress): AT1G77590
Entry
AT1G77590         CDS       T00041                                 

Symbol
LACS9
Name
(RefSeq) long chain acyl-CoA synthetase 9
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT1G77590 (LACS9)
   00071 Fatty acid degradation
    AT1G77590 (LACS9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G77590 (LACS9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT1G77590 (LACS9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G77590 (LACS9)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT1G77590 (LACS9)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT1G77590 (LACS9)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT1G77590 (LACS9)
  Exosomal proteins of breast cancer cells
   AT1G77590 (LACS9)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 844094
NCBI-ProteinID: NP_177882
TAIR: AT1G77590
UniProt: Q9CAP8 A0A7G2E866
LinkDB
Position
1:complement(29148160..29152395)
AA seq 691 aa
MIPYAAGVIVPLALTFLVQKSKKEKKRGVVVDVGGEPGYAIRNHRFTEPVSSHWEHISTL
PELFEISCNAHSDRVFLGTRKLISREIETSEDGKTFEKLHLGDYEWLTFGKTLEAVCDFA
SGLVQIGHKTEERVAIFADTREEWFISLQGCFRRNVTVVTIYSSLGEEALCHSLNETEVT
TVICGSKELKKLMDISQQLETVKRVICMDDEFPSDVNSNWMATSFTDVQKLGRENPVDPN
FPLSADVAVIMYTSGSTGLPKGVMMTHGNVLATVSAVMTIVPDLGKRDIYMAYLPLAHIL
ELAAESVMATIGSAIGYGSPLTLTDTSNKIKKGTKGDVTALKPTIMTAVPAILDRVRDGV
RKKVDAKGGLSKKLFDFAYARRLSAINGSWFGAWGLEKLLWDVLVFRKIRAVLGGQIRYL
LSGGAPLSGDTQRFINICVGAPIGQGYGLTETCAGGTFSEFEDTSVGRVGAPLPCSFVKL
VDWAEGGYLTSDKPMPRGEIVIGGSNITLGYFKNEEKTKEVYKVDEKGMRWFYTGDIGRF
HPDGCLEIIDRKKDIVKLQHGEYVSLGKVEAALSISPYVENIMVHADSFYSYCVALVVAS
QHTVEGWASKQGIDFANFEELCTKEQAVKEVYASLVKAAKQSRLEKFEIPAKIKLLASPW
TPESGLVTAALKLKRDVIRREFSEDLTKLYA
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgattccttatgctgctggtgttattgtgccattggctttgacgtttctggttcagaaa
tctaagaaagaaaagaaaagaggtgttgttgttgatgttggtggtgaaccaggttatgct
attaggaatcacaggtttactgagcctgttagttcccattgggaacatatctcaacgctt
ccagagctctttgagatatcgtgtaatgctcacagtgatagggttttccttggcacccga
aagctgatctctagagagattgagactagtgaggatggaaaaacgttcgagaaactgcat
ttaggtgactacgagtggctcacttttgggaagactctcgaagcagtgtgtgattttgcc
tctgggttagttcagattgggcacaagacggaagagcgtgtcgccatttttgcagatact
agagaagaatggttcatctccctacagggttgcttcaggcgcaacgtcactgtggtaact
atctattcatctttgggagaggaagctctttgtcactcgctgaatgagacagaggtcaca
accgtaatatgtggtagcaaagaactcaaaaagctcatggacataagccaacagcttgaa
actgtgaaacgtgtgatatgcatggatgatgaattcccatctgatgtgaacagtaattgg
atggcgacttcatttactgatgttcagaaacttggccgcgaaaatcctgtggatcctaat
ttccctctctcagcagatgttgctgttataatgtacaccagtggaagcactggacttccc
aagggtgttatgatgacgcatggtaatgtcctagctacagtttcggcagtgatgacaatt
gttcctgaccttggaaagagggatatatacatggcatatttacctttggctcacatcctt
gagttagcagctgagagcgtaatggctactattgggagtgctattggatatgggtctccc
ttgacgctaacggatacttcaaacaagataaaaaagggtacaaaaggagatgtcacagca
ctaaagcccactataatgacagctgttccagccattcttgatcgtgtcagggatggtgtc
cgcaaaaaggttgatgcaaagggcggattgtcaaagaaattgtttgactttgcatatgct
cggcgattatctgcaatcaatggaagttggtttggagcctggggattggaaaagcttttg
tgggatgtgcttgtgttcaggaaaatccgtgcagttttgggaggtcaaatccgctatttg
ctctctggtggtgcccctctttctggtgacactcagagattcattaacatctgcgttggg
gctccaatcggtcagggatatgggctcacagagacttgtgctggtggaaccttctcggag
tttgaggacacatccgttggccgtgttggtgctccacttccttgctcctttgtaaagcta
gtagactgggcggaaggtgggtatctaactagtgataagccgatgccccgtggtgaaatt
gtaattggtggctcaaatatcacgcttgggtatttcaaaaatgaggagaaaactaaagaa
gtgtacaaggttgatgaaaagggaatgaggtggttctacacaggagacataggacgattt
caccctgatggctgcctcgagataatagaccgaaaaaaggatatcgttaaacttcagcat
ggagaatatgtctccttgggcaaagttgaagctgctctaagtataagtccctatgttgaa
aacataatggttcatgctgattcgttctacagttactgtgtggctcttgtggtcgcgtcc
caacatacagttgaaggttgggcttcaaagcaaggaatagactttgccaacttcgaagaa
ctgtgcacgaaagagcaagccgtgaaagaagtgtatgcgtcccttgtgaaggcggctaaa
caatcacgattggagaagtttgagataccagcaaagatcaaattattggcatctccatgg
acgccagagtcaggattagtcacagcagctctaaagctgaaaagagatgtaattaggagg
gaattctctgaagatctcaccaagttatatgcctaa

DBGET integrated database retrieval system