KEGG Orthology (KO) [BR:ath00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
AT2G04630 (NRPB6B)
09124 Replication and repair
03420 Nucleotide excision repair
AT2G04630 (NRPB6B)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:ath03021]
AT2G04630 (NRPB6B)
03400 DNA repair and recombination proteins [BR:ath03400]
AT2G04630 (NRPB6B)
Transcription machinery [BR:ath03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
AT2G04630 (NRPB6B)
RNA polymerase III system
RNA polymerase III
AT2G04630 (NRPB6B)
RNA polymerase I system
RNA polymerase I
AT2G04630 (NRPB6B)
DNA repair and recombination proteins [BR:ath03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
AT2G04630 (NRPB6B)
144 aa
MADDDYNEVDDLGYEDEPAEPEIEEGVEEDADIKENDDVNVDPLETEDKVETEPVQRPRK
TSKFMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRQRKIPFTIRRYLPD
MSYEEWGVDELIVEDSWKRQVGGD