KEGG   Arabidopsis thaliana (thale cress): AT2G29550Help
Entry
AT2G29550         CDS       T00041                                 

Gene name
TUB7
Definition
(RefSeq) tubulin beta-7 chain
  KO
K07375  tubulin beta
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT2G29550 (TUB7)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AT2G29550 (TUB7)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AT2G29550 (TUB7)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G29550 (TUB7)
  Exosomal proteins of colorectal cancer cells
   AT2G29550 (TUB7)
  Exosomal proteins of bladder cancer cells
   AT2G29550 (TUB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 817504
NCBI-ProteinID: NP_180515
MIPS: AT2G29550.1
TAIR: AT2G29550
Araport: AT2G29550
UniProt: P29515 A0A178VS27
LinkDB All DBs
Position
2
AA seq 449 aa AA seqDB search
MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYVGDSELQLERVNVYYNEASCGRYV
PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRNLTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGEYEEEEAEYEQEETY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagattcttcatattcaaggaggtcaatgcggaaaccaaatcggttccaagttt
tgggaagtggttaatctcgagcacgggattgatcagacgggacggtatgtaggagattcc
gagttacagcttgagagggttaatgtatactacaacgaggcgagttgtggaaggtacgtt
cctcgcgctgttctcatggatttggagcctggaaccatggacagtgtcagatctggtccg
tacggtcagatctttcgaccggataacttcgtcttcggtcagtccggtgctgggaataac
tgggctaaaggtcactacactgaaggtgctgagcttattgattcggtccttgatgttgtt
cgcaaagaggctgagaactgtgactgccttcaaggatttcaggtgtgccattccttggga
ggaggaactggttctggaatgggaactttgttgatatctaagatcagggaggagtaccca
gaccgtatgatgatgactttctctgtgttcccatcgcctaaggtgtctgacactgttgtg
gagccttacaacgcaacactatctgtgcaccagcttgttgagaacgctgatgagtgtatg
gttcttgacaacgaagctttgtatgacatttgcttccgtacactcaagcttagcactcca
agttttggtgatctgaaccacttgatctctgcaaccatgtctggtgtaacctgctgtctt
aggttccctggtcaactgaactctgatctgcgaaagctagctgtgaatctgatcccattc
cctcgtctccacttcttcatggtgggatttgctcctctcacctctcgtggatctcagcag
taccgtaacctcactgtcccagagctcactcagcaaatgtgggatgctaagaacatgatg
tgtgctgctgacccaagacacggtcgctacctcactgcttcagccatgttccgtggaaag
atgagcaccaaggaggtcgatgaacagatgctgaacgtacagaacaagaactcctcctac
tttgtggaatggatccctaacaacgtcaaatcaaccgtctgtgacattccccctactggt
ctgaagatggcttcaacgttcattggtaactcaacttcgatccaagagatgttcaggcgt
gtcagtgagcaattcactgctatgttcaggagaaaggctttcttgcattggtacacaggt
gaaggtatggatgagatggagttcactgaagctgaaagcaacatgaacgatcttgtctct
gagtatcagcagtatcaagatgcaacggctgatgaagaaggagaatatgaagaggaagaa
gctgagtacgagcaagaagaaacttattga

DBGET integrated database retrieval system