KEGG   Arabidopsis thaliana (thale cress): AT2G30200
Entry
AT2G30200         CDS       T00041                                 
Symbol
EMB3147
Name
(RefSeq) EMBRYO DEFECTIVE 3147
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
Module
ath_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT2G30200 (EMB3147)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AT2G30200 (EMB3147)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT2G30200 (EMB3147)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     AT2G30200 (EMB3147)
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT2G30200 (EMB3147)
SSDB
Motif
Pfam: Acyl_transf_1
Other DBs
NCBI-GeneID: 817570
NCBI-ProteinID: NP_565697
TAIR: AT2G30200
UniProt: Q8RU07
LinkDB
Position
2:complement(12882948..12885776)
AA seq 393 aa
MRSLLHRTILLTSPSHSLIRRTSLSAMATTASSSLLLPSISLNNLSSSKNASFGFAAKNL
SRSRISMSVSAGSQSTTVHDSLFADYKPTSAFLFPGQGAQAVGMGKESQSVGAAGELYKK
ANDILGYDLLDICVNGPKEKLDSTVISQPAIYVTSLAAVELLRVREGGEQIINSVDVTCG
LSLGEYTALAFAGAFSFEDGLKLVKLRGEAMQAAADAAKSAMVSIIGLDSEKVQQLCDAA
NQEVDEADKVQIANYLCPGNYAVSGGLKGIEVVEAKAKSFKARMTVRLAVAGAFHTSFME
PAVSRLEAALAATEIRSPRIPVISNVDAQPHADPDTIKKILARQVTSPVQWETTVKTLLS
KGLKSSYELGPGKVIAGIFKRVDKSASFENISA
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcgttcactgcttcaccgtactatcttactcacatctccgtctcattctcttatccgg
cgcacttctctctccgccatggccaccaccgcctcctcttccttgctcctcccttccata
tctctcaacaatctctcctcctctaaaaatgcctcctttggcttcgccgccaagaatctc
agccgatctaggatttctatgagcgtctctgctggatctcagagtactactgttcacgat
tctctgttcgctgattacaaacccacctctgcttttctctttcccggtcagggagctcaa
gcagtaggaatgggaaaagagtctcagagtgttggagcagctggagagttgtataagaaa
gctaatgatatcttagggtatgatcttttggatatttgtgttaatggaccaaaagagaag
cttgattctacggtcataagccagcctgctatttatgtcacaagtttagcagcagttgaa
ttgctccgtgttcgtgaaggcggagaacaaataattaactcggttgatgtgacttgcggt
ctcagtttgggagagtatactgctctggcttttgctggagccttcagcttcgaggacggg
ctgaagcttgtaaaacttagaggagaagctatgcaggctgctgcagatgctgctaagagt
gccatggttagtatcatagggttggactcagaaaaggttcagcagttgtgtgatgcagca
aatcaagaagtagatgaagctgacaaagttcagatcgcaaattacttatgtccgggtaat
tacgcagtatctggaggtcttaaaggaatcgaagttgttgaagccaaagctaagtcattc
aaagcacgaatgacggtgcgtctagctgttgcaggtgctttccacactagtttcatggaa
ccagcagtctcgagattagaagctgcattggcagccacagagatcagaagtccgaggatc
ccagtgatctcgaatgtcgatgcacagcctcatgcagatccagacacgatcaagaagata
cttgcacgccaggtgacatctccagtccaatgggagacaacagtaaagactctcttatcc
aaaggacttaaaagcagctacgaattgggacctggaaaggtaattgcagggatattcaag
agagtagataaaagcgcaagtttcgaaaacatcagtgcttga

DBGET integrated database retrieval system