KEGG   Arabidopsis thaliana (thale cress): AT3G05970
Entry
AT3G05970         CDS       T00041                                 

Symbol
LACS6
Name
(RefSeq) long-chain acyl-CoA synthetase 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT3G05970 (LACS6)
   00071 Fatty acid degradation
    AT3G05970 (LACS6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G05970 (LACS6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT3G05970 (LACS6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G05970 (LACS6)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT3G05970 (LACS6)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT3G05970 (LACS6)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT3G05970 (LACS6)
  Exosomal proteins of breast cancer cells
   AT3G05970 (LACS6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 819767
NCBI-ProteinID: NP_566265
TAIR: AT3G05970
UniProt: Q8LPS1 A0A5S9X9I0
LinkDB
Position
3:complement(1786279..1791887)
AA seq 701 aa
MDSSSSSSSAAARRRINAIHSHLVTSSRSSPLLRSNPTAGEFCLDNGYSVVLPEKLNTGS
WNVYRSAKSPFKLVSRFPDHPDIATLHDNFEHAVHDFRDYKYLGTRVRVDGTVGDYKWMT
YGEAGTARTALGSGLVHHGIPMGSSVGIYFINRPEWLIVDHACSSYSYVSVPLYDTLGPD
AVKFIVNHATVQAIFCVAETLNSLLSCLSEMPSVRLVVVVGGLIESLPSLPSSSGVKVVS
YSVLLNQGRSNPQRFFPPKPDDVATICYTSGTTGTPKGVVLTHANLIANVAGSSFSVKFF
SSDVYISYLPLAHIYERANQILTVYFGVAVGFYQGDNMKLLDDLAALRPTVFSSVPRLYN
RIYAGIINAVKTSGGLKERLFNAAYNAKKQALLNGKSASPIWDRLVFNKIKDRLGGRVRF
MTSGASPLSPEVMEFLKVCFGGRVTEGYGMTETSCVISGMDEGDNLTGHVGSPNPACEVK
LVDVPEMNYTSADQPHPRGEICVRGPIIFTGYYKDEIQTKEVIDEDGWLHTGDIGLWLPG
GRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFVGQCFIYGDSFNSSLVAVVSVDPDV
LKSWAASEGIKGGDLRELCNNPRVKAAVLSDMDTVGREAQLRGFEFAKAVTLVLEPFTLE
NGLLTPTFKIKRPQAKEYFAEAITNMYKELGASDPSANRGL
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggattcttcttcttcgtcttcctccgccgccgcacgccgccgtatcaacgctatccac
tctcacctcgtcacctcttctcgctcttcccctctcctccgctccaatcccaccgccggc
gagttctgtcttgataatggctatagtgttgttcttcccgagaaactgaatactggcagt
tggaacgtctacagatctgcaaaatctccgttcaagctcgttagcagattcccagatcat
cctgacatcgctactctccatgacaattttgagcatgctgttcatgattttcgagattac
aagtatttaggaactcgtgttcgtgtcgacggaactgttggagactacaaatggatgaca
tatggagaagctggtacagcaagaactgctttaggttctggtttggttcatcacggaatc
cccatgggatcttctgttggaatttacttcatcaatcgcccagagtggctcattgttgat
catgcttgttcttcttattcttatgtgtctgttcctttgtatgatactcttggtcctgat
gctgtgaaatttattgtcaatcatgcaactgtgcaagccatattttgtgtggcagagact
ttaaactctttacttagctgtttgtctgagatgccaagtgtacgcctggtggtggttgtt
ggagggttaattgaatctttaccctcgcttccctcatcatcaggagtgaaagttgtatcc
tattcggtgttactgaatcagggtcgtagtaaccctcagcgattttttccaccaaaaccc
gatgatgttgcaaccatatgctatacaagcggaacaactgggacacccaagggagtcgta
ttaactcatgcaaacttgattgccaatgttgctggctccagctttagtgtgaagtttttc
tcttcagatgtttacatttcgtatcttccacttgctcacatttacgaacgagctaatcag
atcctaacagtgtactttggagttgctgttggattctaccaaggggacaatatgaaacta
ctggatgatttggctgctctgagacctactgtatttagcagtgtccctcgattatacaat
agaatatatgctggtatcattaatgcagtaaaaacctctggtggtctgaaagagagactc
ttcaatgctgcctataatgcaaagaagcaggctctcttgaatggaaagagtgcttctccc
atatgggacaggttggtatttaataaaataaaggacagacttggagggcgggttcgtttt
atgacgtctggtgcttcacctctctctcctgaagtgatggaatttttgaaagtatgcttt
ggaggaagggtaacagagggatatggaatgactgaaacatcttgtgttataagtggaatg
gacgagggtgataacctcactggacatgttggctctcctaatccagcttgtgaagtaaag
cttgtggatgtcccagaaatgaactatacatcagcggatcagccccatccccgtggcgaa
atatgtgttaggggtcctatcatttttacaggctattacaaagatgaaattcaaacgaaa
gaggtgattgatgaagatggatggcttcacactggagatataggtctgtggctgccggga
ggacgtctaaaaattattgacagaaagaagaacatcttcaaattggcgcagggggagtat
atagctccagagaaaattgaaaacgtctatgccaaatgcaaatttgtgggccagtgcttc
atatatggtgatagctttaattcatcattggtagctgttgtatcggttgatccagatgtg
ctgaaaagctgggcagcttcagaaggcattaagggaggagatctgagagaattgtgtaat
aatccgagagtgaaagcagcagtactatctgacatggacactgttggaagagaagctcag
ttgagaggcttcgagtttgcaaaggctgtgacattggtgctggaaccatttactctggaa
aatggcttgttgactccgacgttcaagattaagagaccacaagcaaaggaatatttcgca
gaagcaataacaaacatgtacaaggagcttggtgcttctgatccctctgctaatagaggt
ttgtga

DBGET integrated database retrieval system