KEGG   Arabidopsis thaliana (thale cress): AT3G22630
Entry
AT3G22630         CDS       T00041                                 
Symbol
PBD1
Name
(RefSeq) 20S proteasome beta subunit D1
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    AT3G22630 (PBD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT3G22630 (PBD1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ath03051]
    AT3G22630 (PBD1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     AT3G22630 (PBD1)
Peptidases and inhibitors [BR:ath01002]
 Threonine peptidases
  Family T1: proteasome family
   AT3G22630 (PBD1)
Proteasome [BR:ath03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    AT3G22630 (PBD1)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 821834
NCBI-ProteinID: NP_188902
TAIR: AT3G22630
UniProt: O23714 A0A178VMP5
LinkDB
Position
3:complement(8009540..8010862)
AA seq 204 aa
MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYV
QKNVSLYKFRNGIPLTTAAAANFTRGELATALRKNPYSVNILMAGYDDESGASLYYIDYI
ATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVVAPPNFVIK
IVDKDGARDYAWRQSVKDVTTAVV
NT seq 615 nt   +upstreamnt  +downstreamnt
atggagtgtgtattcggtcttgttgggaatggattcgccatcgttgctgctgatacatcg
gcggttcatagtatccttcttcacaaaaacaacgaagacaagatcatggtacttgactca
cacaagcttgttgctgctagtggcgagcctggtgaccgggttcagtttacggagtacgtt
cagaagaatgtgtccttgtacaaattcagaaatggaatcccgttgactaccgccgctgct
gccaatttcactcgcggagagctcgctactgctttgaggaagaatccgtattcggtgaat
atcctgatggctggctatgacgatgagtctggtgcatcactttactacatcgactacatt
gcaactcttcacaaagtcgacaagggagcttttggttacggctcctacttctccctctcc
acgatggacaggcattaccgcagtgacatgtctgtagaagaagccattgaactagttgac
aaatgcatacttgagatccggtcaagactcgttgttgcaccaccaaactttgtgatcaag
attgttgacaaagatggagctcgtgattacgcttggcgtcagtccgtaaaggatgtcaca
actgctgttgtctga

DBGET integrated database retrieval system