KEGG   Arabidopsis thaliana (thale cress): AT4G11030
Entry
AT4G11030         CDS       T00041                                 

Name
(RefSeq) AMP-dependent synthetase and ligase family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00071  Fatty acid degradation
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT4G11030
   00071 Fatty acid degradation
    AT4G11030
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G11030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ath01004]
    AT4G11030
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT4G11030
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AT4G11030
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AT4G11030
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AT4G11030
  Exosomal proteins of breast cancer cells
   AT4G11030
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 826704
NCBI-ProteinID: NP_192841
TAIR: AT4G11030
UniProt: Q9T009
LinkDB
Position
4:6738068..6742424
AA seq 666 aa
MTSQKRFIFEVEAAKEATDGNPSVGPVYRSTFAQNGFPNPIDGIQSCWDIFRTAVEKYPN
NRMLGRREISNGKAGKYVWKTYKEVYDIVIKLGNSLRSCGIKEGEKCGIYGINCCEWIIS
MEACNAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEKKIPELFKTCPNSTKYMKTVV
SFGGVKPEQKEEAEKLGLVIHSWDEFLKLGEGKQYELPIKKPSDICTIMYTSGTTGDPKG
VMISNESIVTITTGVMHFLGNVNASLSEKDVYISYLPLAHVFDRAIEECIIQVGGSIGFW
RGDVKLLIEDLGELKPSIFCAVPRVLDRVYTGLQQKLSGGGFFKKKVFDVAFSYKFGNMK
KGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQGYGL
TESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKTLFS
GYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLENVYS
QVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFILGEL
VKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQNVIHEMYKTTKE
SLASGQ
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgacgtcgcagaaaagattcatctttgaggtggaagccgctaaggaagccacagatgga
aatccctcggttggtcctgtctatcgtagtacttttgctcagaacggattcccgaacccg
atcgatggtatccaaagctgctgggatattttccgcacggctgttgagaagtatccaaac
aatcgaatgcttggtcgccgtgagatttcgaacgggaaggcaggaaagtacgtgtggaaa
acatacaaagaagtatacgacattgtcataaaacttggaaattctctacgtagttgcggg
attaaggagggagaaaaatgtggtatatatggtataaattgttgtgagtggatcattagc
atggaggcatgtaatgcacatggcctttattgtgtccctttatacgatacgttaggcgct
ggtgcagtggaattcatcatttctcatgcagaggtttcaattgctttcgtggaggagaag
aagatccctgagctttttaagacttgtccaaactcaacaaaatatatgaagactgttgtg
agctttggcggtgtcaaaccggaacaaaaagaagaagctgaaaaattgggattggtaata
cattcgtgggatgagtttttgaagctgggtgagggtaagcaatatgagcttcccattaaa
aagccaagcgacatatgcacgattatgtatactagcggaacaactggtgacccgaaggga
gttatgatttcaaatgaaagcattgttactataactactggagtgatgcatttcctaggg
aatgtgaatgcaagcctatctgagaaggatgtgtatatttcttatcttcctctcgcgcac
gtctttgatcgggcaatcgaggaatgtattattcaagtaggtggttcaattggtttctgg
cgcggggatgtcaaattgttgattgaagaccttggtgagctaaaaccaagtatcttttgc
gccgttcctcgtgtcctagatcgagtatacacaggactacagcagaaactatctggtggt
ggtttcttcaaaaagaaggtgtttgatgttgctttttcctataaatttggaaatatgaag
aaaggacagtctcatgtggcagcttctccattttgtgacaaacttgtattcaacaaggtt
aaacaaggacttggaggcaatgtgaggattattctgtctggagcggctcctctcgctagt
cacatagaatcttttctaagagttgttgcatgttgtaatgttctacaaggatatggtcta
actgagagttgtgctggaacttttgcaacgttcccagacgaactagacatgcttgggact
gttggtccacccgtgccaaacgtcgatatacgccttgaatctgtcccggaaatgaattat
gatgctcttggaagtactccgcgaggcgaaatatgcatacgaggaaaaactttattttca
gggtactacaaacgtgaagacctcacaaaagaggtttttatcgacggatggttgcacaca
ggtgatgttggtgagtggcaaccaaatggaagcatgaagataattgaccggaaaaagaac
atcttcaaactcgcgcaaggagagtatgtcgctgttgagaatttagaaaatgtctacagt
caagtagaagttattgaatcgatatgggtatatggaaacagctttgagtccttccttgtc
gcaatcgctaacccggcccaacaaactcttgaacgatgggctgtggagaatggagtgaat
ggagacttcaactccatctgccaaaacgcaaaggcaaaagcattcatacttggagaactc
gttaaaacagccaaagagaacaagttgaagggttttgagatcataaaagatgttcatctg
gaaccagtggcgttcgacatggaacgagaccttcttactccaacctacaaaaagaagagg
cctcaattgctcaaatactatcagaatgtgatccatgaaatgtacaagacaacaaaggaa
agtctagcttccggacagtaa

DBGET integrated database retrieval system