KEGG   Arabidopsis thaliana (thale cress): AT4G14800
Entry
AT4G14800         CDS       T00041                                 
Symbol
PBD2
Name
(RefSeq) 20S proteasome beta subunit D2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    AT4G14800 (PBD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT4G14800 (PBD2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ath03051]
    AT4G14800 (PBD2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     AT4G14800 (PBD2)
Peptidases and inhibitors [BR:ath01002]
 Threonine peptidases
  Family T1: proteasome family
   AT4G14800 (PBD2)
Proteasome [BR:ath03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    AT4G14800 (PBD2)
SSDB
Motif
Pfam: Proteasome DUF4761
Other DBs
NCBI-GeneID: 827135
NCBI-ProteinID: NP_193216
TAIR: AT4G14800
UniProt: O24633 A0A178UVU0
LinkDB
Position
4:8500193..8502589
AA seq 199 aa
MECVFGLVGNGFAIVAADTSAVHSILLHKNKEDKIMTLDSHKLVAASGEPGDRVQFTEYV
QKNVSLYQFRNGIPLSTAAAANFTRGELATALRKNPYSVNILMAGYDKEAGASLYYIDYI
ATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVIAPPNFVIK
IVDKDGAREYGWRISTADA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggagtgtgtatttggtctagttgggaatggattcgctatcgtggcggcggatacatca
gcagttcacagtattcttcttcacaagaacaaagaggacaagatcatgactcttgactct
cacaagctcgtcgccgctagtggtgagcctggtgaccgggttcagtttacggagtatgtt
cagaagaatgtgtcactgtatcagtttcgtaatgggattcctttgagtactgctgctgct
gctaacttcactcgtggagaacttgccactgctttgagaaagaatccatattcggtgaac
atcctgatggctggctatgacaaagaagccggcgcatctctatactacattgactacatt
gcaaccctccacaaggttgataagggagcatttggatacggctcatacttctctctctct
acaatggacagacactaccgcagcgacatgtctgttgaagaagccattgaattggtggac
aaatgcatactcgagatcaggtcaaggctggtcattgcaccaccaaactttgttatcaag
attgttgacaaggacggagcccgtgagtacggatggcgtatcagcactgctgatgcctaa

DBGET integrated database retrieval system