KEGG   Azospirillum thiophilum: AL072_23495Help
Entry
AL072_23495       CDS       T04091                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ati  Azospirillum thiophilum
Brite
KEGG Orthology (KO) [BR:ati00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL072_23495
Enzymes [BR:ati01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AL072_23495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 AlaDh_PNT_C HI0933_like Glutaredoxin DAO K_oxygenase NAD_binding_7 FAD_binding_3 FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALG73994
UniProt: A0A0F2KQW2
LinkDB All DBs
Position
4:complement(126781..128379)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLERITQPIELVASLDGGPKAQEMLGLLEDIASLSDKITLVRDGKDER
RPSFAINRVGSDIGVTFAGLPMGHEFNSLVLALLQVGGHPSKESAELLEQIRNLDGDFRF
ETYFSLTCQNCPDVVQALNLMSALNPRIKHVAIDGALFQQEVEQRQVMAVPTVYLNGEPF
AQGRMDVAQIVAKLDTGAVARAAEKIKAKAPFEVLVIGGGPAGAAAAVYAARKGISTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLAAALEQHVKDYDVDIMNLQTATALVPPTQEGG
LIEVKLASGASLKSRTVVLSTGARWRSMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVAHVTLIEFDSQLRADAVLQRKLHSLPNVDVIVSGQTTEVHGDG
SKAVGLSYKDRTSGEQKRIDLEGIFVQIGLVPNTEWLKGSIALTPRGEIEVDARGQTSIP
GVFAAGDATTVPYKQIVIAMGEGAKAALSAFDHLIRTVPVEESRPAAMEAAE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaagacgcagttgaaggcctatctggagcgcatcacccagccg
atcgaactggtcgcgtcgctcgacggcgggccgaaggcgcaggagatgctgggcctgctg
gaggacatcgcctcgctgtcggacaagatcacgctggtccgcgacggcaaggacgagcgc
cggccctccttcgcgatcaaccgggtcggcagcgacatcggcgtcaccttcgccggcctg
ccgatgggccatgaattcaactcgctggtgctggcgctgctccaggtcggcggccatccg
tcgaaggaatcggccgagctgctggaacagatccgcaacctcgacggcgatttccgcttc
gagacctacttctcgctgacctgccagaactgcccggacgtggtgcaggcgctgaacctg
atgagcgcgctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgagcagcggcaggtgatggccgtgccgaccgtctacctgaacggcgagcccttc
gcccagggccggatggacgtggcgcagatcgtcgccaagctcgacaccggcgcggtggcc
cgcgccgccgaaaagatcaaggccaaggcgccgttcgaggtgctggtgatcggcggcggc
ccggccggcgcagccgccgcggtctatgccgcccgcaagggcatcagcaccggcgtcgcg
gccgagcggttcggcggccaggtgctcgacaccatggcgatcgagaacttcatctcggtc
tcccacaccgaggggccgaagctggcggcggcgctggagcagcacgtcaaggactatgac
gtcgacatcatgaacctgcagaccgccaccgccctggtgccgccgacgcaggaaggcggg
ctgatcgaggtgaagctggccagcggcgcctcgctgaagtcgcgcacggtggtgctgtcg
accggcgcccgctggcgctcgatgaacgtcccgggcgaggccgagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggcggcgatcgacctcgccggactggtggcgcatgtc
accctgatcgagttcgacagccagctgcgcgccgacgcggtgctccagcgcaagctgcac
agcctgccgaacgtcgacgtcatcgtctcgggccagaccaccgaggtgcatggcgacggc
agcaaggccgtcggcctgtcctacaaggaccggaccagcggcgagcagaagcggatcgat
ctggaaggcatcttcgtgcagatcggtctggtgcccaacaccgaatggctgaagggctcc
atcgccctgaccccgcgcggcgagatcgaggtggacgcccgcggccagacctccatcccc
ggcgtcttcgctgccggcgacgcgacgacggtgccttacaagcagatcgtcatcgccatg
ggcgagggcgccaaggcggcgctgtcggccttcgaccacctgatccgcaccgtcccggtc
gaggaatcgcgcccggcggcgatggaagcggcggagtaa

DBGET integrated database retrieval system