KEGG   Aegilops tauschii (wheat D): 109745687Help
Entry
109745687         CDS       T04345                                 

Gene name
LOC109745687
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03030  DNA replication
ats03410  Base excision repair
ats03420  Nucleotide excision repair
ats03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109745687 (LOC109745687)
   03410 Base excision repair
    109745687 (LOC109745687)
   03420 Nucleotide excision repair
    109745687 (LOC109745687)
   03430 Mismatch repair
    109745687 (LOC109745687)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ats03032]
    109745687 (LOC109745687)
   03400 DNA repair and recombination proteins [BR:ats03400]
    109745687 (LOC109745687)
Enzymes [BR:ats01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109745687 (LOC109745687)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109745687 (LOC109745687)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109745687 (LOC109745687)
DNA replication proteins [BR:ats03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109745687 (LOC109745687)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109745687 (LOC109745687)
DNA repair and recombination proteins [BR:ats03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109745687 (LOC109745687)
   NER (nucleotide excision repair)
    Other NER factors
     109745687 (LOC109745687)
   MMR (mismatch excision repair)
    Other MMR factors
     109745687 (LOC109745687)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase TrmB Presenilin
Motif
Other DBs
NCBI-ProteinID: XP_020160391
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MFLPRATTSLHSLLRCQFRPLPSPKTLAITLAPPPLLLCPRLCSSSSSSSRRAPTAAVKS
GEKRPPARLRRAEAVPPLAAGGAAMSSSGGAGGKRSVADVLMGNARDAARKAKKGAPAAS
GVPSPKKPRTKTAAEADGATAERAVDEKPPSPAKSPVKSKRPSSPPKSKSKADDAPEAKK
RSPSPTRSKTLAAAAKLEAAEKPLSPKRAKTLAAKSDAKPSDQALVSQSKDQASQSEDKK
TKISNATKSEEVNTTLELKKKGSEFDPMAAAYWKPGEPVPFLFLARALDLISNESGRIVI
TEILSNVFRTIIATTPEDLLATVYLSANRIAPPHEGIELGIGDASIIRALSEAYGRKEEH
VKKNLKELGDLGLVAKASRSSQKMMYKPKPLTISRVLDTFRTIAKESGKDSQDKKRSHIK
GLLVAATDCEPQYIIRLLQSKMRIGLAEKTVQMALGQAAVYSEKGSPPKKVQSPFEEAAK
IIKEAYSVLPIYDKIVPTLLDAGVWKLPETCNFSIGVPVGPMLAKATKSVSEIIDKFQGR
EYTCEYKYDGERAQIHCMEDGTVEIYSRNAERNTGKYPDVVDAISRIRKPTVKSFVLDCE
IVAYDREKKRILPFQILSTRARKGVTINDIKVSVCTFGFDILYINGKPLLQEQLKVRREH
LYNSFEEVPGVFQLATAITSNDLEEIQKFLDLSVNSSCEGLIIKTLDTDATYEPAKRSNN
WLKLKKDYMDSVGDSLDLVPIAAFHGRGKRTGVYGSFLLACYDEHNEEYQTICNIGIFFV
TLNYLNGESILYILHIYIIVGTGFSEQQLEERSTSLRSKVIKNPKAYYRFADTTDPDVWF
EPSEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLRVRDDKNPEHATTAEQVADM
YRAQKINHSHNQEDEDDD
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgttcctccctcgagccaccacctcgctccactccctgctgcgatgccagttccgcccg
ctcccctcgcctaaaaccctagccattaccctcgccccgccgcccctgctcctctgcccc
cgcctctgctcctcttcctcctcctcctcccgccgcgcccccactgccgccgtcaaatcc
ggcgagaagaggccgcccgcgaggttgaggagggcggaggcggtgccgccgctagccgcg
ggaggagcggccatgtcgtcctcgggaggcgccggggggaagcgctccgtggcggatgtg
ctcatggggaacgcgcgggacgccgccaggaaggccaagaagggggccccggccgcctcc
ggggtcccgtctccgaagaagcccaggacgaagacggccgccgaggccgacggcgcgacg
gccgagcgggcggtggacgagaaaccgccttcgccggccaagtcgcccgtcaagtcaaag
cgcccgtcgtcgccacccaagtccaagtcgaaggccgacgacgctcctgaggccaagaag
aggtccccgtcgcccacgaggtccaaaacgctagccgcggccgcgaaattggaggccgcg
gagaagcccctgtcgccgaagagggccaaaaccctagcggccaaatctgacgccaagccc
tctgaccaagcccttgtctctcaatctaaagaccaagcgtctcaatccgaggataagaag
accaaaatctcaaatgccaccaagtcagaggaggtgaataccactctcgagctcaagaag
aaaggcagtgagtttgatcccatggctgctgcctactggaagcctggcgagcctgtgcca
ttcctcttcttggctcgggcactcgacctcatctccaacgagtctggccggattgtcatt
acagagatcctgtcaaacgtgttccgtacgattattgccacaacaccagaggatctcctt
gccacagtatacctctcggctaaccggattgcgccacctcacgaagggattgagcttggt
attggggatgcatcaatcatccgtgcactttccgaggcatatggccgcaaagaggagcat
gtcaaaaagaacctcaaggaattgggtgatttggggcttgtggcaaaagcaagcaggtcg
tcacagaagatgatgtacaagccaaaaccactgacaatatcacgtgtgcttgataccttt
cgtacaatcgcaaaggaatctggcaaagacagtcaagataagaaaagaagccatatcaaa
ggacttcttgttgctgcaacagactgtgaaccccaatacattatacgacttcttcagtcg
aagatgcgtattgggttggcagagaaaactgtccaaatggctcttgggcaagctgctgta
tattctgaaaaagggtccccgccaaaaaaagtccaatcaccttttgaagaggccgcaaaa
ataattaaagaagcatattcagttcttccaatctatgataaaattgtcccgactcttctt
gatgctggtgtttggaaacttccagaaacatgcaatttctccataggtgtccctgttggt
cctatgttggcaaaagcaacgaaatctgtctcagagattatcgacaagtttcaaggtcgt
gagtacacttgtgagtacaagtatgacggtgaacgggcccagattcattgcatggaggat
ggaacagtagaaatttatagtcggaacgctgaaaggaatactgggaagtaccctgatgtt
gttgatgcaatttctagaatccgaaagcctacagttaagtcatttgtcttagattgcgaa
attgttgcttatgaccgcgaaaagaaaagaattttaccctttcagatactcagcacaagg
gcccgcaagggtgttactataaatgacatcaaagtatcagtctgtacttttggctttgat
atcctttacatcaatgggaaacctcttctccaggaacaacttaaagttcgccgagagcat
ctttacaactcttttgaggaagtgccaggtgtttttcaactggcaactgcaattacatca
aatgacctcgaggagatacaaaaatttcttgacttatctgtcaactccagttgtgaaggg
ttgattatcaagacattggatacggatgctacatatgagccggcgaagcggtcaaacaat
tggttgaaattgaagaaagattacatggacagtgttggagactctttagacttagtgcca
attgctgcttttcatggaagaggaaaacgaacaggtgtatatgggtcgttcctcttggca
tgctatgatgagcataatgaagaataccaaacaatctgcaatataggtatattttttgta
accctaaattacttgaatggtgaatcaattctttatattcttcatatttatataattgta
ggtactggattttctgagcaacaacttgaagaacgttctacgagccttcgaagtaaagta
ataaagaacccaaaggcatattataggttcgctgacacaactgacccagatgtgtggttt
gagccgtcagaggtgtgggaggtcaaagctgctgatttgagcataagtccagttcatcgt
gctgctaatgggatagttgatccaaataagggtatctctctaagatttcctcgtttgttg
cgggtgcgtgatgataaaaacccagaacatgcaaccacagctgagcaagttgctgacatg
tatcgtgctcaaaaaataaaccactcgcacaaccaagaagatgaggatgatgactga

DBGET integrated database retrieval system