KEGG   Agrobacterium fabrum: Atu1318
Entry
Atu1318           CDS       T00070                                 

Gene name
gatC
Definition
(RefSeq) glutamyl-tRNA-Gln-amidotransferase chain C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
atu  Agrobacterium fabrum
Pathway
atu00970  Aminoacyl-tRNA biosynthesis
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Atu1318 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:atu03029]
    Atu1318 (gatC)
Enzymes [BR:atu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Atu1318 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Atu1318 (gatC)
Mitochondrial biogenesis [BR:atu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Atu1318 (gatC)
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-GeneID: 1133356
NCBI-ProteinID: NP_354324
UniProt: Q8UFS9
LinkDB
Position
circular:1308566..1308853
AA seq 95 aa
MSVDLATVKRVARLARIAVSEEEAQNMLGQLNGILGFVEQLSEVNVDGVEPMTSVTPVEM
KKRADVVTDGNKADDIVANAPATDRDFFMVPKVVE
NT seq 288 nt   +upstreamnt  +downstreamnt
atgtccgtcgatctcgccaccgtaaagcgcgttgcgcgccttgcccgtatcgctgtcagc
gaagaagaagcacagaatatgctcggccagctgaacggcatactcggtttcgtggagcag
ctttcggaagtgaatgtcgatggcgtcgagccgatgacgtcagtcacgccggtggagatg
aaaaagcgtgcagacgtggtgaccgacggcaacaaggcggacgacattgtcgccaatgcg
cccgcgaccgaccgggacttcttcatggtcccgaaagtggtcgaataa

DBGET integrated database retrieval system