KEGG   Aurantimicrobium sp. MWH-Uga1: AURUGA1_00019Help
Entry
AURUGA1_00019     CDS       T05539                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
auw  Aurantimicrobium sp. MWH-Uga1
Brite
KEGG Orthology (KO) [BR:auw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:auw01001]
    AURUGA1_00019 (prkC)
Enzymes [BR:auw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AURUGA1_00019 (prkC)
Protein kinases [BR:auw01001]
 Serine/threonine kinases: Other
  Bacterial family
   AURUGA1_00019 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like WaaY Seadorna_VP7 PIP49_C Kdo Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AXE53738
UniProt: A0A344W0K1
LinkDB All DBs
Position
complement(14914..16656)
Genome map
AA seq 580 aa AA seqDB search
MSEHKQVIAGRYELGKLVGSGGMAEVYIAHDAVLGRKVAIKVLNEDLANNKKFLSRFQQE
ARSASSLTHPNIVKVLDSGEETVTDSDGTEHVRAYMVMEYVEGLELSKLVARGPLKVPEA
VRVAGEILNAVEFAHSAGIVHCDIKPDNIMITRQGNVKVLDFGIARAAAAAFDDLAQTTS
VLGTAAYFSPEQAQGKKVDARTDIYAIGVVLFEMLTGKVPFEGDTAVAVAHQHIHAQPVA
PSTFNAKVTPALDAVVLKALSKAPKDRYQSTHAFGAALQDAASGKVVVPETKPEPIEELL
GPISEPALEKTDTSSNELPAEFAFLFGDDPQTAPTLVQPEEFRPEPKRVVAIVGIVALVF
GAIAGMGLWVATLKPVNLFPTSTVTVPELKGETYEAAEKELKDLGLYPTKVEESSGLVKT
GRVIRTEPGKETVIEPGALVQVFVSTGKSKVAIPDVSGLPIEEAKTTITDAGFKVGLVTE
STNPTVAAGAVIATDPVFGTQRFQGATVNISVSNGKIDIPDVRGKSVAEASNLLGDLNLF
PVVQADMGCTKAAEPTVRSQSVPPGLSNQGVPITLSYCAG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaacataagcaggtaattgccggccgatacgagctaggcaaacttgttggcagt
ggcggtatggctgaggtatatatcgcccatgatgctgtcttgggcagaaaagttgcgatc
aaagttctcaatgaggacttagcgaacaacaagaagtttctctcacgattccagcaagaa
gcacgctctgcttcttcgctaactcatcccaacatcgtcaaagttctcgattcgggtgaa
gaaaccgtcacagattccgacggaaccgaacatgttcgtgcctacatggtcatggagtac
gtcgaaggcctcgagctttccaaactggttgcccgtggtccgttaaaggttcccgaagca
gttcgcgttgccggagaaattctcaatgcggttgagtttgcccacagcgctggaatagtt
cactgcgatatcaagcccgacaacatcatgattacccgtcagggaaatgtaaaggttctc
gatttcggtattgcccgtgctgcagcagctgcttttgacgaccttgcccaaacaacttct
gtgttgggaactgccgcctatttctcccccgagcaggctcagggcaagaaggtcgacgct
cgcaccgacatttatgcaattggcgtggtgctctttgaaatgctcaccggcaaggttcct
tttgaaggagacactgctgttgccgtggctcaccaacacattcacgcgcagcctgttgca
cccagcacattcaacgcaaaggtgactccagctctagatgctgttgtgctgaaagcacta
tctaaagcacccaaggatcgataccaatcaacacatgcctttggcgcagcactgcaggac
gctgcctcaggcaaggttgtcgttcctgagacgaaacccgagcccatcgaagagcttctt
ggccctatctccgagcctgctcttgaaaagactgacacgtcgagtaatgaattacctgcc
gagtttgcattcctctttggagacgacccacaaactgctccaactctggttcagcctgaa
gaattcaggcctgaacctaaacgggttgtggcgattgttggaattgttgccctggtcttc
ggtgcgattgcaggtatgggtctgtgggtggcaaccctcaaacccgtcaatctgttcccc
accagcacggtgactgttcctgaactcaagggtgaaacctatgaggctgcagaaaaagag
ttgaaagatctcggtctttatcccacgaaagtggaagagagcagtggcttagtaaaaact
ggcagggttattcgcaccgaaccgggtaaagaaactgtgatcgagcctggtgccctcgtt
caagttttcgtctcgaccggaaagtccaaagttgctattcctgatgtatcaggtcttcca
atagaagaagcgaaaacgacaatcacagacgctggcttcaaggttgggctcgtcactgaa
tcaacaaaccccaccgttgctgcaggtgcagtcattgcaactgaccccgttttcggaacg
caacgtttccaaggtgccacggtcaacatctccgtctccaacggaaagatcgatattcct
gacgtgcgcggcaagagcgtggccgaagcaagtaacttgcttggcgatctcaacttgttc
ccagttgttcaagcagatatgggctgcacgaaagctgcagaacctactgttcgatcacag
tccgtgcctcctgggctgtcgaaccagggtgttcccattaccctcagctactgcgctggc
tag

DBGET integrated database retrieval system