KEGG   Aeromonas veronii B565: B565_2245Help
Entry
B565_2245         CDS       T01462                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
avr  Aeromonas veronii B565
Pathway
avr00473  D-Alanine metabolism
avr00550  Peptidoglycan biosynthesis
avr01100  Metabolic pathways
avr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B565_2245
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B565_2245
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B565_2245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
    B565_2245
Enzymes [BR:avr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B565_2245
Peptidoglycan biosynthesis and degradation proteins [BR:avr01011]
 Precursor biosynthesis
  Amino acid ligase
   B565_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEB50280
LinkDB All DBs
Position
complement(2533704..2534693)
Genome map
AA seq 329 aa AA seqDB search
MKNMHVLLLCGGGGSEHEVSLRSANFLEQQLGLLSGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQNEAALAEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALRAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHRFSDYLEQILRKAS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggcggtggctccgagcacgaggtttct
ctgcgcagcgccaatttcctcgagcaacaactgggccttctgtccggtgtcgaagtgacc
cgcgtcgagatgttcgccgatcgctggctcagtgccgatggccgcgagtgcaagctgggg
ctcgacaagctgctttcgttcgacagcgtggcccgtccggtggattacgtggtgccctgc
atccacggctacccgggtgagaccggcgatctgcaatccttcctcgaactggccggattg
ccttatctcggttgcgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctccgccatcggcattcccaacaccccgtacctattcctgaccgagcaaaat
gaggcggcgctggccgaggccaaagccgcgctggccaagtggggcaaggtctttatcaag
gccgcttcccagggctcttccgttggctgctactccgccagcaacgaagcggatctggtg
aagggcattgccgatgcatttggttactccgaacaggttctgatcgagaaagcggtcaag
ccgcgtgagctggaagtggcggtttaccagtatggtgacgagctggtggccacctatccg
ggcgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agccataccgagaccgcactgcgtgccgaggggctgacccaggcgcaggccgatgcgatc
cacgagtatgctctcaaggcgttccgtcagctgaaactgacccatctctcgcgcatcgac
ttcttcctgactgaggagggggagatcctgctgaatgaaatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcaccgcttctctgactac
cttgagcagatcctgcgcaaggccagctaa

DBGET integrated database retrieval system