KEGG   Anabaena sp. wa102: AA650_12270Help
Entry
AA650_12270       CDS       T04059                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
awa  Anabaena sp. wa102
Brite
Enzymes [BR:awa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AA650_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: ALB41144
UniProt: A0A0K2LZP6
LinkDB All DBs
Position
2832834..2833433
Genome map
AA seq 199 aa AA seqDB search
MAFTQPALPFASDALESYGMKAETFEYHYGKHHKAYVDNLNKLVDSTELANKSLEEVIQI
AFGDSTKAGIFNNAAQVWNHSFFWNCLKPAGGGTPTGALAAKIDQDFGSFDKFKEEFSNA
AATQFGSGWAWLVDDGGTLKVMKTPNAENPLAHGKKALLTIDVWEHAYYIDFKNARPAFI
KNFLDNLVNWDFVAANFAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacccaaccagctttaccttttgcttctgatgctttagaatcctatggcatg
aaggctgaaacctttgaatatcactatggtaagcatcataaagcttatgtagataatttg
aataagcttgttgatagcacagaattagccaacaagtctttggaagaagtaattcaaatc
gcttttggtgattctaccaaagctggaatcttcaacaatgctgctcaagtttggaatcac
tccttcttctggaattgcttgaaaccagcaggtggcggcactcctacaggcgcattagct
gctaaaattgatcaggattttggtagtttcgacaaattcaaagaagaattttctaacgct
gctgcaactcaattcggtagtggttgggcttggttggttgatgatggtggtactctgaaa
gtaatgaaaacccccaacgccgaaaaccccctcgcacacggtaaaaaagctctgttaacc
attgacgtttgggaacacgcatattacattgacttcaaaaatgcccgtcctgcattcatc
aagaatttcttagataatttggtgaactgggattttgtcgctgcaaatttcgctgcttag

DBGET integrated database retrieval system