KEGG   Azoarcus sp. DN11: CDA09_02835
Entry
CDA09_02835       CDS       T05691                                 

Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_02835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_02835
Enzymes [BR:azd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CDA09_02835
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CDA09_02835
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase AAA_22 AAA_24 AAA RuvB_N
Other DBs
NCBI-ProteinID: AYH42334
UniProt: A0A3Q8HQA4
LinkDB
Position
635586..636992
AA seq 468 aa
MATQKRRFENSGDPAISAIKLPPHSLEAEQSLIGGILLDNQAWERVADLASETDFYRDDH
RRIFRHISKLLDLGKPADVVTVFESLEKNGESEQAGGLAYLAEIANGTPSAANIRRYAEI
VRERAILRKLVSVGDEIAASALSATGRDAKTLLDEAEAKVFEIAESSARSTTGFVSIQPI
LKQVVDRVQELYDRDNPSEVTGVPTGLVDLDDKTSGLQPSDMIIVAGRPAMGKTTFALNI
AEHVAIDCKLPVAIFSMEMPGTQLATRFISSVGRIDQGKIRTGRLGDEDWQRLTMAMGKL
YDAPLFIDETPGLNPIDLRARARRLSRQCGKLGLIVIDYLQLMVGTKESDNRAAELSEIS
RSIKSLAKELHVPIVALSQLNRSLEQRPNKRPVMSDLRESGAIEQDADIIMFIYRDEVYN
PDSPDKGTAELIIGKHRNGPTGTVRMTFIGECTRFENYAGGSGFYQSE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggccactcaaaagcgccgcttcgaaaactccggtgatcctgcgatctcggcaatcaag
ctcccgccgcactcgctcgaagccgagcaatccctgattggcggcattctgctcgacaac
caggcctgggagcgcgtcgccgatctcgccagcgaaaccgatttctatcgcgacgaccat
cgacgcatcttccggcatatcagcaagctgcttgacctcggcaagcctgccgacgtcgtc
accgtcttcgaatccctcgagaaaaacggcgaatccgagcaggccggcgggctcgcctat
cttgcggagatcgccaacggcacgccatcggccgccaacatccgccgctacgccgaaatc
gtccgcgagcgcgcgatcttgcgcaaactcgtgagcgtcggcgacgagatcgccgcgtcc
gcgctcagcgcgaccggccgcgacgccaagaccctgctcgacgaagcggaagccaaggtc
ttcgagatcgccgaatcgagtgcccgcagcaccaccggctttgtctcgatccagcccatt
ctcaagcaggtcgtcgaccgcgtgcaggagctctacgaccgcgacaacccctcggaggtc
acgggcgtgccgaccggtctggttgacctcgacgacaagacgtccggcctccagccctcg
gacatgatcatcgtcgccggccgtcctgcgatgggcaagaccacctttgcgctcaacatc
gccgagcacgttgccatcgactgcaaactgcccgtcgcgatcttctcgatggaaatgccc
ggcacccagctcgcgacccgcttcatctcctcggttggccgcatcgaccagggaaagatc
cgcaccggccggctcggtgacgaggactggcagcgcctcacgatggcgatgggcaaactc
tacgacgccccgctcttcatcgacgagacgcccggcctcaaccccatcgacctgcgtgcc
cgagcgcggcgcctttcgcgccaatgcggcaagctcggcctcatcgtcatcgactacctg
caactcatggtcggcaccaaggagagcgacaaccgcgccgccgagctgtccgagatctcg
cgctcgatcaagtcgctcgccaaggaactgcacgtccccatcgtcgccctgtcccagctc
aaccggagcctcgagcagcgccccaacaagcgcccggtgatgtcggacctgcgcgaatcg
ggcgccattgagcaggacgcggacatcatcatgttcatctaccgggacgaggtctataac
ccggactcgcccgacaagggcacggccgaactcatcatcggcaagcatcgtaacggcccg
actggaactgtgcgcatgacctttatcggcgaatgcacgcgtttcgagaattacgcgggc
gggtcgggtttttatcagagcgaatga

DBGET integrated database retrieval system