KEGG   Azospirillum sp. CFH 70021: DEW08_27500Help
Entry
DEW08_27500       CDS       T05917                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azz  Azospirillum sp. CFH 70021
Brite
KEGG Orthology (KO) [BR:azz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DEW08_27500
Enzymes [BR:azz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DEW08_27500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C DAO FAD_binding_3 Glutaredoxin Thi4 NAD_binding_7 FMO-like K_oxygenase NAD_binding_8 DUF3467
Motif
Other DBs
NCBI-ProteinID: AWK89729
UniProt: A0A2S2CZ32
LinkDB All DBs
Position
unnamed2:594446..596047
Genome map
AA seq 533 aa AA seqDB search
MLDANLKTQLRGYLERISQPIELVASLDDGAKSQELQGLLEDIASLSDKITLVRRDDDAR
KPSFSIHRVGTDIAVRFAGLPMGHEFNSLVLALLQVGGHPSKESAELIEQIKDLDGDYRF
ETYFSLSCQNCPDVVQALNLMSALNPRIRHVAIDGALFPEEVEKRQVMAVPTVFLNGEPF
AQGRMGLEQIVAKLDSGAVEREAAKIRTKAPFDVLVIGGGPAGASAAIYAARKGIRTGIA
AERFGGQVLDTMAIENFISVPHTEGPKLAAALEQHVKDYEVDVMNLQRAEALVPAAVPGG
LIEVRLAGGATLKSRTVILSTGARWRQMNVPGESEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVTVVTSGQTTEVHGDG
SKVTGLSYKDRNSGELKRIDLEGIFVQIGLVPNTEWLKGTIALTPRGEIEVDARGQTSVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRTPAAEEPRAVAAAEAVG
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgcaaatctgaagacccagctgcggggctatctggagcgcatcagccagccg
atcgagctggtcgcctcgctcgacgacggtgccaagtcgcaggaactgcaggggctgctc
gaggacatcgcgtccctgtccgacaagatcacgctggtgcgccgcgacgacgacgcgcgc
aagccgtccttctccatccaccgcgtcggcaccgacatcgccgtgcgcttcgccggcctg
ccgatgggccacgaattcaactcgctcgtcctcgccctgctccaggtcggcggccatccg
tcgaaggaatcggccgagctgatcgagcagatcaaggacctcgacggcgactaccgcttc
gagacctatttctcgctgtcctgccagaactgccccgacgtggtgcaggcgctgaacctg
atgagcgcgctcaacccgcggatccggcatgtcgccatcgacggcgccctgttcccggag
gaggtcgagaagcgccaggtcatggccgtcccgaccgtcttcctgaacggcgagccgttc
gcccagggccgcatggggctggagcagatcgtcgccaagctcgacagcggcgccgtggag
cgcgaggccgccaagatccggaccaaggcgccgttcgacgtgctggtgatcggcggcggc
ccggccggcgcctcggccgcgatctacgccgcccgcaagggcatccgcaccggcatcgcg
gcggagcgcttcggcggccaggtgctcgacaccatggcgatcgagaacttcatctccgtc
ccgcacaccgaggggccgaagctggccgccgcgctggagcagcacgtcaaggactatgag
gtcgacgtgatgaacctgcagcgcgccgaggcgctggtcccggccgccgtgccgggcggg
ctgatcgaggtgcggctggccggcggcgccacgctgaagtcgcggaccgtcatcctgtcc
accggcgcgcgctggcggcagatgaacgtcccgggcgagagcgagtaccgcaacaagggc
gtcgcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggcggccatcgacctcgccggcatcgtcgcccaggtg
acgctgatcgagttcgacagccagctccgcgccgacgcggtgctgcagcgcaagctgcac
tccctgccgaacgtcacggtcgtcacctcgggccagacgaccgaggtccatggcgacggc
agcaaggtgaccggcctcagctacaaggaccgcaacagcggcgagctgaagcggatcgac
ctggagggcatcttcgtgcagatcggcctcgtccccaacaccgagtggctgaagggcacc
atcgccctgaccccgcgcggcgagatcgaggtggatgcccgcggccagacctccgtcccc
ggcgtgttcgccgccggcgacgccacgaccgtgccctacaagcagatcgtgatcgccatg
ggcgaggggtccaaggcggcgctgtcggccttcgattacctgatccgcacccctgcggcg
gaagaaccccgcgccgtcgcggcggccgaagcggtcgggtaa

DBGET integrated database retrieval system