KEGG   Burkholderia ambifaria MC40-6: BamMC406_5241Help
Entry
BamMC406_5241     CDS       T00684                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00250  Alanine, aspartate and glutamate metabolism
bac00410  beta-Alanine metabolism
bac00640  Propanoate metabolism
bac00650  Butanoate metabolism
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BamMC406_5241
   00650 Butanoate metabolism
    BamMC406_5241
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BamMC406_5241
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BamMC406_5241
Enzymes [BR:bac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BamMC406_5241
Amino acid related enzymes [BR:bac01007]
 Aminotransferase (transaminase)
  Class III
   BamMC406_5241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACB67686
UniProt: B1Z184
LinkDB All DBs
Position
2:2446026..2447309
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIAEQLNSFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVSTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNSLQADVPQIADVRGPGAMIAVEFLK
PGSGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgtgatttctacgcagcccgcgccgagaatgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccatcgccacccgaag
atcgtcaaggcgatcgcggagcaactgaacagcttcacgcacaccgcttaccagatcgtg
ccgtacgcgtcgtacgtcgagctggccgagaagatcaacgaacgcgcgccgggcgacttc
ccgaaaaagacggccttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcacgcgccgcgaccggccgtccgggtgtcatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgccccgtacccgaacgcgctgcacggcgtgtcgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcaccggccgagttc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
caaaccggcttcgcccgcaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgcgccgacgtgatggacgcggcggcgcccggcggcctcggcggcacctatgcgggcaac
ccgctggcggtcgcatcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaattcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcctgaag
ccgggttcgggcgagccggacgccgacttcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcgggctgctgctgctcgtatgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgattccgcaggccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gagacggtcggcgtgccggcctga

DBGET integrated database retrieval system