KEGG   Bacillus sp. 1NLA3E: B1NLA3E_18440Help
Entry
B1NLA3E_18440     CDS       T02643                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00040  Pentose and glucuronate interconversions
baci00051  Fructose and mannose metabolism
baci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B1NLA3E_18440
   00051 Fructose and mannose metabolism
    B1NLA3E_18440
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     B1NLA3E_18440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AGK55432
UniProt: N0AZK2
LinkDB All DBs
Position
complement(3989050..3990081)
Genome map
AA seq 343 aa AA seqDB search
MKAVMKLEPGYDKMSLENIPEPNVFDDKVKIKVAYTGICGSDIHTFKGDYSNPKTPVVLG
HEFSGVVVEVGPDVKNVKVGDRVTSETTYTTCGACEYCLEGNYNLCPDRKGLGTQENGSF
AEYVISREESVHVLPEEVSLLAASLTEPLACCVHAVLEKTTVSAKDRVLIFGPGPIGLLL
LQVVKAQGAFVIMSGITKDAKRLELAKSLGADVIVDTLQEDLKEIVLANTNGYGVDKIFE
CSGAVPALNSGLPLMKKKGTFVQVGLFGNKLNAIDQESIIQREISYVGSRSQKPSSWVIA
LDLLKNNKVDTDKMITKMVSLDEWRTGFEAVMAGNEIKVIVES
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaatgaaactagaacccggttatgacaaaatgtcacttgagaatattcca
gaaccgaatgtctttgatgataaggttaaaataaaagtagcttacaccggaatctgtggc
tctgatatccacacttttaaaggagactacagcaaccctaaaacgcctgttgttcttggt
catgaattttcaggtgttgttgttgaagttggaccagacgtgaaaaatgtgaaggttggc
gatcgtgtaacaagcgaaactacctatacaacttgtggagcatgtgagtactgtctagag
ggcaattataatttgtgtcctgatcgtaaggggttaggaactcaggaaaatggaagtttc
gcagaatatgttatttcccgtgaggagagtgttcatgtactgcctgaagaagtcagcctt
ttagccgcttctttgactgagcctttagcttgttgtgtacatgctgtactagagaaaaca
acagtgagtgcaaaggatagagtcctaatctttggaccaggaccaattggtttactgctt
cttcaagttgtaaaagcacaaggggcatttgttatcatgtcaggaattactaaggatgct
aaacggttagaattagctaaatctttaggtgctgatgtcattgtagatacgctacaagag
gatcttaaagagatagtccttgccaatacaaatggttatggtgttgataaaatctttgaa
tgttctggtgcagtacctgcgttaaattcaggtttgcctcttatgaagaaaaaaggaaca
tttgtacaagttggcctgtttggtaataaattaaatgcaatcgatcaagaatcgatcatc
caacgtgagatctcttatgttggtagccgttcacaaaaaccaagttcttgggttattgct
cttgatctattaaaaaataataaagttgatacagataaaatgattaccaagatggtttca
ttagatgaatggcggacaggctttgaagctgttatggccggaaatgaaatcaaggtaatc
gtagaatcttaa

DBGET integrated database retrieval system