KEGG   Bacillus sp. OxB-1: OXB_2126Help
Entry
OXB_2126          CDS       T03635                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00564  Glycerophospholipid metabolism
baco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OXB_2126
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OXB_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N GIDA GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: BAQ10597
UniProt: A0A0A8JJP5
LinkDB All DBs
Position
2211677..2213320
Genome map
AA seq 547 aa AA seqDB search
MFSAVQRTRTARLMANHQFDLLVIGGGITGAGIALDAVTRGLSVALVEMQDFAAGTSSRS
TKLIHGGLRYLKQLEVKIVAETGHERDIVYRNAPHVTEPERMLLPFYKGGTFGKHMTSAG
LFVYDLLAGVKKDERREMLTPGETLRMEPLLKRDGLLGGGHYVEYRTDDARLTIETMKKA
VERGALCLNYAKAEQFIYDNGKVIGVTVHDCWENRTFPVHASVVVNATGPWVDEVREKDA
YSNDKRLRLSKGVHLVIDRSVFPLRQAIYFDAPDGRMIFAIPRGKKAYIGTTDTFYEGDP
ANPLATEEDVRYLLEAVHHLFPEVPIRRTDVESTWAGVRPLIFEEGKDPSDISRKDEVWE
ADSGLITIAGGKLTGYRKMAETVVDRVAKRLHAASAGPCVTEHLPLSGGEFRDDRHYRDF
IEMKGDEAVRFGLSREEGCRLASFYGTNVDKVFLYAHAMKEEGSALPVSLKAEIFYAIHH
EMVLTPSDFFIRRHGDLYFQVDRVKSVKEAATAFMAKLLSYSEVQEHRLLQELKLHLAEA
ELKGGTD
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagctgtgcaaaggacccgtaccgcccgtttgatggccaaccatcaattcgac
ctgcttgtcatcggcggaggcatcacgggggcggggatcgccttggatgcagtgactcgg
ggattgtcggtcgctttggtcgagatgcaggattttgccgccgggacatcgagccgctcg
accaagctcatccatggcggcttgcgctatttgaagcaattggaagtgaaaatcgtagcg
gagaccgggcatgaacgggatatcgtctatcggaatgcccctcatgtgaccgagccggag
cggatgctgcttcccttttacaaaggcggcacattcggcaagcatatgacatcggcgggt
ttattcgtctatgatctgctggccggggtgaaaaaggacgagcgccgggaaatgctgaca
cccggggagacgcttcggatggagccgttgctcaagcgggatggtttgctgggcggcggc
cattacgtcgaataccggacggacgatgcccgtttgacgatcgaaacgatgaaaaaagcg
gtggaacgaggagcgctatgtctgaattacgccaaagccgaacagtttatatatgacaac
ggcaaggtaatcggtgtgacggtccacgattgctgggaaaaccggacgttccctgtccat
gcgagcgtcgtcgtgaatgcaacggggccatgggtcgatgaagtgcgggaaaaggatgcc
tattccaatgataagcggctgcgtttatcgaaaggggttcatctggtcatcgatcggtcg
gtgttcccgttgcgccaagcgatttatttcgatgcgccggacggccggatgatctttgcc
attccacgggggaagaaggcatatattggaacaacggacacgttttacgaaggagatcca
gcaaacccattagcgacggaggaagatgtccggtatttactggaagcggtgcatcatctc
tttcccgaggttccgatcaggcgtactgatgtggaatcgacgtgggccggcgtccgtccg
ctcattttcgaagaaggcaaggatccgtcggatatttcgcggaaagacgaagtatgggaa
gcggacagcgggttgatcacgattgcgggcggcaaactgacgggctatcggaaaatggcc
gagaccgtggtggaccgggtcgcaaaaaggctgcatgcagcatctgccggcccgtgcgtg
acggagcatcttccgctatcgggcggagagttccgggacgatcggcattaccgggacttc
attgaaatgaaaggggacgaagcagtccggtttggattgtcacgggaggaagggtgtcgg
ctggcctcgttttacgggaccaatgtcgataaggtgttcctgtatgctcatgcgatgaaa
gaggaagggagcgcgttgccggtttcattgaaggcggagattttctatgcgatccatcat
gaaatggtgctgacgccgtccgatttcttcatccggcggcatggggatctttactttcag
gtcgatcgggtcaaatctgtcaaagaagccgcaacagccttcatggcaaagttgctatcc
tactcggaagtccaggagcaccgactgctgcaagagctgaaacttcatctcgcggaagcg
gaacttaaggggggaacggattga

DBGET integrated database retrieval system