KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012188
Entry
103012188         CDS       T03086                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012188 (GADD45G)
   04064 NF-kappa B signaling pathway
    103012188 (GADD45G)
   04068 FoxO signaling pathway
    103012188 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103012188 (GADD45G)
   04210 Apoptosis
    103012188 (GADD45G)
   04115 p53 signaling pathway
    103012188 (GADD45G)
   04218 Cellular senescence
    103012188 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012188 (GADD45G)
   05202 Transcriptional misregulation in cancer
    103012188 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103012188 (GADD45G)
   05212 Pancreatic cancer
    103012188 (GADD45G)
   05225 Hepatocellular carcinoma
    103012188 (GADD45G)
   05226 Gastric cancer
    103012188 (GADD45G)
   05214 Glioma
    103012188 (GADD45G)
   05216 Thyroid cancer
    103012188 (GADD45G)
   05220 Chronic myeloid leukemia
    103012188 (GADD45G)
   05217 Basal cell carcinoma
    103012188 (GADD45G)
   05218 Melanoma
    103012188 (GADD45G)
   05213 Endometrial cancer
    103012188 (GADD45G)
   05224 Breast cancer
    103012188 (GADD45G)
   05222 Small cell lung cancer
    103012188 (GADD45G)
   05223 Non-small cell lung cancer
    103012188 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103012188 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103012188 (GADD45G)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103012188 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103012188 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103012188
NCBI-ProteinID: XP_007193478
UniProt: A0A384B1N3
LinkDB
Position
Un
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLGAIVGTGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggacacggttcccgaaagcacggccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtctgcgcaacgccagggttgcctcacc
gccggcgtctacgagtccgccaaagttctgaacgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgctctgcagatccacttcactttg
atacaggcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagagg
ctgggggcgatcgtcggtaccggcgacgaggcgggtgcgccgggggacctgcactgcatc
ctcatttcgaaccccaacgaggacgcatggaaggaccccgccttggagaaactcagcctg
ttctgcgaggagagtcgcagcgtcaacgactgggtgcccaatatcaccctccccgagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016967
Entry
103016967         CDS       T03086                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103016967 (GADD45B)
   04064 NF-kappa B signaling pathway
    103016967 (GADD45B)
   04068 FoxO signaling pathway
    103016967 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103016967 (GADD45B)
   04210 Apoptosis
    103016967 (GADD45B)
   04115 p53 signaling pathway
    103016967 (GADD45B)
   04218 Cellular senescence
    103016967 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016967 (GADD45B)
   05202 Transcriptional misregulation in cancer
    103016967 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103016967 (GADD45B)
   05212 Pancreatic cancer
    103016967 (GADD45B)
   05225 Hepatocellular carcinoma
    103016967 (GADD45B)
   05226 Gastric cancer
    103016967 (GADD45B)
   05214 Glioma
    103016967 (GADD45B)
   05216 Thyroid cancer
    103016967 (GADD45B)
   05220 Chronic myeloid leukemia
    103016967 (GADD45B)
   05217 Basal cell carcinoma
    103016967 (GADD45B)
   05218 Melanoma
    103016967 (GADD45B)
   05213 Endometrial cancer
    103016967 (GADD45B)
   05224 Breast cancer
    103016967 (GADD45B)
   05222 Small cell lung cancer
    103016967 (GADD45B)
   05223 Non-small cell lung cancer
    103016967 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103016967 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103016967 (GADD45B)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103016967 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103016967 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103016967
NCBI-ProteinID: XP_007176661
UniProt: A0A383ZNI6
LinkDB
Position
Un
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCP
LVSNPHTDAWKSHGLVEVASYCEESRENNQWVPYIPLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagactgtgagc
gccgcggtggaggagctgctggtggctgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgccttctggct
attgacgaggaggaggaggacgatatcgccctgcagatccacttcacgctcatccagtcc
ttttgctgtgacaacgacattgacatcgtgcgggtgtcaggaatgcagcgcctggcacag
ctgctgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgcccc
ctggtcagcaaccctcatacagacgcctggaaaagccacggcttggtggaggttgccagt
tactgcgaagagagcagggagaacaaccagtgggtcccctacatccccctccaggagcgc
tga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020367
Entry
103020367         CDS       T03086                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103020367 (GADD45A)
   04064 NF-kappa B signaling pathway
    103020367 (GADD45A)
   04068 FoxO signaling pathway
    103020367 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103020367 (GADD45A)
   04210 Apoptosis
    103020367 (GADD45A)
   04115 p53 signaling pathway
    103020367 (GADD45A)
   04218 Cellular senescence
    103020367 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020367 (GADD45A)
   05202 Transcriptional misregulation in cancer
    103020367 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103020367 (GADD45A)
   05212 Pancreatic cancer
    103020367 (GADD45A)
   05225 Hepatocellular carcinoma
    103020367 (GADD45A)
   05226 Gastric cancer
    103020367 (GADD45A)
   05214 Glioma
    103020367 (GADD45A)
   05216 Thyroid cancer
    103020367 (GADD45A)
   05220 Chronic myeloid leukemia
    103020367 (GADD45A)
   05217 Basal cell carcinoma
    103020367 (GADD45A)
   05218 Melanoma
    103020367 (GADD45A)
   05213 Endometrial cancer
    103020367 (GADD45A)
   05224 Breast cancer
    103020367 (GADD45A)
   05222 Small cell lung cancer
    103020367 (GADD45A)
   05223 Non-small cell lung cancer
    103020367 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103020367 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103020367 (GADD45A)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103020367 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103020367 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103020367
NCBI-ProteinID: XP_007171717
UniProt: A0A383Z9H2
LinkDB
Position
Un
AA seq 171 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVPVPARSDPDNV
VLCLLAADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLESDAGPALSE
GAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 516 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggctgccaagctgctcaacgtccctgtccctgcccgcagcgaccccgataacgtg
gtgctgtgcctgctggcggcggacgaggacgacgacagggacgtggctctgcagatccac
ttcaccctgatccaggcgttctgctgcgagaacgacatcgacatcctgcgcgtcagcaac
cctggccggctggccgagctcctgctgctggagagtgacgcgggccccgcgttgagcgag
ggcgccgagcagcccccggacttgcactgcgtgctggtgacgaatccacattcatcacag
tggaaggatcctgccttaagtcaacttatttgtttttgccgggaaagccgctacatggat
cagtgggtgccagtgattaatctccctgaacggtga

DBGET integrated database retrieval system