KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017852Help
Entry
103017852         CDS       T03086                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103017852 (TGM3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103017852 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103017852
NCBI-ProteinID: XP_007184275
UniProt: A0A384AAB1
LinkDB All DBs
Position
Un
AA seq 1084 aa AA seqDB search
MANGTVANATQAEVSKHVLLFEALRPPSEEPELACWKRQTQPSQLRPQTNQPVNGQTGTI
THLGWPRVPVVAHVTGPDHITIPEAWPGSSGAGARVSRRRRHAGLGGSCWLWPEWLSVGP
RFQEQESGESLSVSKAHFYPATPPPREGLNVWVTKHRGEERELPGADRSPHRIQANAVSL
KPGYPGFLPAPSQSSDCSPAAGAARCSPDYRETRVPVPGWRNPDLRLQIQGARRPPPDPA
PCDSSPWLLITMATRGRSGNFRVLGARLLPRDPASSGSSWLRRITVATWEISGLGRGDLE
RPRVLLTLRSDPGADQVEDSIVTLRILQRTGLCPALGPPRAQAVSAVPLCTLRLTYVVKN
TRSELRLLGLVTLPSPRLFICKWWISSLLFCLAALELKSVNWQTADNGQAHHTDKFFSQE
LVVRRGQLFYMSVTLHRSLSHREVTFTASTGPYPSESTKTKAVFPLSNKIRGTGWGAQLM
YNKNNVLSISILSPANAPIGRYSLSIQISSEGNYSTLKLGTFILLFNPWLQADSVFMSNH
DEREEYVQEDSGIIFMGRASYISLIGWNYGQFEEGILNICLSLLDNSLNFRRDPVNDVAR
RDDPQYIGRVLSAMINNNDDYGVIAGNWSGNYTGGQHPRHWNGSVEILKKWQISGFRPVR
YGQCWVFAGTLNTALRCLGIPSRVITNFSSAHDTDQNLSVDVYYDPRGWPMDKGSDSIWN
FHVWNEAWFKRTDLSPSYSGWQVLDATPQERSQGVFQCGPASVIALREGNVDWDFDMPFI
FAEVNADRITWIYNSWTGSLKKNSSDSDIVGKYISTKAVGSNTRMDVTENYKYPEGSRQE
RQAFEKALGKLKPYMAFRATAAGRLSTAELKPSISGKFKITGALTVGKEVNLALMFKNLT
SDSKTVMVNMTAWTIVYNGTLVHEVWKDSVTLTLGPEEEIQHPVKIAYALYEKYLKADNM
IRATAVCRVTDETEVVVERDIILDNPTLTLEVLDQAQVQKPVTVKVLFSNPLDELVTDCK
LMVEGSGLLLDSLKIDMPTLNPRQQSYVDFEILPTRSGTKQLLANFSCNKFPAIKGMLSI
KVNK
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgggacagttgcaaatgcgacacaagcagaggtttcaaagcacgtgctgctc
tttgaggctctgagaccacccagtgaagaacctgagctagcctgctggaagagacagacc
cagccatcccagctgaggccccagaccaaccaacccgtcaacggccagacaggcaccatc
acacaccttgggtggccaagggttccggtggtggcccacgtcactggcccagaccacatc
accatccctgaagcctggcctggtagctcgggggctggggctcgagtctcccgaaggcgt
cgtcacgccgggctgggtggtagctgctggctgtggcctgagtggctctccgtggggcct
cgcttccaagagcaagagtccggggagagtctctctgtctccaaagcccatttctacccc
gccaccccgccgccccgggaaggattgaatgtgtgggtaacaaagcacaggggggaggag
agggaactgcctggagctgacaggtccccgcacaggatccaagcgaacgctgtgtccctg
aagcctgggtacccgggattcctgccagccccctcccagagcagtgactgcagccccgcg
gcgggagccgcaaggtgctcccccgactaccgggagacgagagtgcctgtaccagggtgg
aggaatccggacctccgcctccagatccagggtgctcgcaggcccccaccggacccagcc
ccttgcgactcgtctccctggctcctcatcaccatggcaacccgggggcgctcgggcaac
tttcgggtcctgggcgcgcgcctactgccccgggaccccgcctcttctggctcttcttgg
ctgcgccgcatcaccgtggcaacttgggaaatctccgggttggggcgcggcgatctggag
aggccgagggtcctcctcacactcagatctgaccccggcgcggaccaggttgaagattcc
atcgtgacgctccgtatcctgcagcgaacaggtctctgcccagcgcttggtccccctcgc
gcccaggctgtatcagctgtcccgctctgcacgctgcggcttacctacgtggttaaaaac
acgcgctctgagctgagactgctaggactggtaaccctccccagccccaggctcttcatc
tgcaagtggtggatctcaagtcttcttttctgtcttgcggctttagaactcaagagtgtc
aactggcagacagccgacaatgggcaggcacatcacacagacaagttcttcagccaggag
cttgtcgtgcggagaggccaactcttctacatgtcagtgaccttacaccgaagtctcagc
catagagaagtgacattcacagcttccacagggccttacccctcagagtcgaccaagaca
aaggctgtgtttccactctccaacaagatacgtggcactggctggggtgcacaacttatg
tacaacaagaacaatgttctgagcatctccatcctcagtcctgccaatgcacccatagga
aggtactcgctgagcattcagatctcctccgagggcaattactccactctgaaacttgga
acattcatactgctctttaacccctggttgcaagccgatagtgtctttatgagcaaccat
gatgagagagaggagtatgttcaggaagattctggcatcatcttcatgggaagagcaagt
tacattagcctgattggctggaactatggacagtttgaagaaggcattctgaacatttgc
ctctctctgctggataatagtctgaattttcgccgtgaccctgttaatgatgtggcccgc
agagacgacccccagtatattggccgggtgctgagtgcaatgatcaataacaatgatgac
tatggtgtgattgctgggaactggagtggtaactacacaggtggccagcacccaaggcac
tggaatggcagcgtggagatcctcaagaagtggcaaatttctggcttcaggccagtccga
tacggccagtgctgggtcttcgctgggaccctcaacacagcgctgcggtgtttggggatt
ccctcccgagttatcaccaacttcagctcagctcatgacacagaccaaaacctcagcgtg
gacgtgtactatgaccccagaggatggcccatggacaaaggcagtgacagcatatggaat
ttccacgtctggaatgaagcctggtttaagcggactgacctaagcccatcatacagtgga
tggcaggttctggacgccaccccccaggaaaggagccaaggggtgttccagtgcggccct
gcttcggtcatcgctctccgagagggtaatgtggactgggacttcgacatgcccttcatc
tttgccgaggttaatgccgaccgcatcacatggatctacaattcctggaccggtagcctg
aagaagaattcctcagactctgacatcgttggcaaatacatcagtaccaaggcggtgggc
agcaacactcgcatggatgtcaccgaaaattacaagtacccagaaggttccagacaggaa
aggcaagcatttgaaaaggctttggggaaacttaaaccctacatggcatttagagcaaca
gctgcaggaagattgagcacagcggaactgaagcccagcatatccgggaagttcaagatc
actggcgcactgacagtgggcaaagaagtcaacctggccctgatgttcaaaaacctaacg
agtgattcgaagacagtgatggtgaacatgacagcctggaccatcgtctacaatggcaca
cttgtacacgaggtgtggaaggactccgtcaccctaaccctgggtcccgaagaagaaata
cagcatcctgtaaagatcgcatatgctctgtatgagaagtacctgaaggcagacaacatg
atccgggccacagccgtgtgccgggtcaccgacgagactgaggtggtggtggagagggac
atcatcctggacaaccccaccctgaccctggaggtgctggaccaggcccaggtgcaaaag
cctgtgaccgtgaaggtactcttctccaacccgctggatgagctggtgacggactgcaag
ctgatggtggaggggagcggcctgctgctggacagcctcaagatcgacatgccaacgctg
aaccccaggcagcagtcctatgtggattttgagatcctgcccacccggagtggcaccaag
cagctcctcgccaacttctcctgcaacaagttccccgcgatcaagggcatgctgtccatc
aaagtgaacaagtga

DBGET integrated database retrieval system