KEGG   Bacillus anthracis A0248: BAA_5004
Entry
BAA_5004          CDS       T00892                                 

Gene name
leuS
Definition
(GenBank) leucine--tRNA ligase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bai00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAA_5004 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bai01007]
    BAA_5004 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bai03016]
    BAA_5004 (leuS)
   03029 Mitochondrial biogenesis [BR:bai03029]
    BAA_5004 (leuS)
Enzymes [BR:bai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BAA_5004 (leuS)
Amino acid related enzymes [BR:bai01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAA_5004 (leuS)
Transfer RNA biogenesis [BR:bai03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAA_5004 (leuS)
 Prokaryotic type
    BAA_5004 (leuS)
Mitochondrial biogenesis [BR:bai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAA_5004 (leuS)
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1d
Other DBs
NCBI-ProteinID: ACQ46248
UniProt: C3PBK0
LinkDB
Position
complement(4528380..4530788)
AA seq 802 aa
MSFNHQEIEKKWQGYWEENKTFRTPDETEKPKFYALDMFPYPSGAGLHVGHPEGYTATDI
LSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQIKSLGFSYDW
DREVNTTDPNYYKWTQWIFLKLFEKGLAYVDEVPVNWCPALGTVLANEEIIDGKSERGGH
PVERRPMRQWMLKITAYGDRLLEDLDELDWPESLKDMQRNWIGRSEGAEVHFNIDGTDEK
FTVFTTRPDTLFGASYCVLAPEHALVADITTADQKEAVEAYINSVKMKSDLERTELAKEK
TGVFTGAYAVNPVNGEKLPIWIADYVLATYGTGAVMAVPAHDERDYEFASTFNLPMKEVV
KGGDITKEAYTGDGAHVNSAFLDGLNKEEAIAKMIEWLEVTSAGNQKVTYRLRDWLFSRQ
RYWGEPIPVIHWEDGTMTAVKEEELPLVLPKTENIRPSGTGESPLANIDEWVNVVDPETG
KKGRRETNTMPQWAGSCWYYLRYIDPNNSEALVDPEKVKQWLPVDIYIGGAEHAVLHLLY
ARFWHKVLYDIGVVPTKEPFQQLFNQGMILGENNEKMSKSKGNVVNPDDIVASHGADTLR
LYEMFMGPLDASIAWSENGLDGARRFLDRVWRLFVQDNGELSEKITDAPNKDLEKAYHQT
VKKVTEDYAELRFNTAISQMMVFINDAYKAETLPKEYVEGFVKMIAPVAPHIGEELWSKL
GYNETITYASWPTFDESKLVEDEVEIVVQVMGKVRAKLTMSKDASKDEMEKLALEAIQDQ
IEGKTVRKVIVVPGKLVNVVAN
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgagctttaatcatcaagaaattgagaagaagtggcaagggtactgggaagagaataaa
acattccgtacgccagatgagacagaaaaaccaaaattttatgcactagatatgttccca
tatccatcaggtgcaggcctacacgtaggacatccagaaggttatacagcaacggatatt
ttatctcgtatgaagcgtatgcaagggtataacgttcttcatccaatgggatgggatgca
ttcggtcttccagcagagcaatatgcacttgatactggaaacagcccggctgaatttaca
gagcataatattaatacgttccgtaaccaaattaaatcattaggtttctcttacgattgg
gaccgtgaagtaaatacaacagatccaaactactacaagtggacacaatggatcttccta
aaactatttgaaaaaggcttagcttacgttgatgaagtacctgtaaactggtgcccagca
cttggtacagtacttgcaaacgaagaaatcattgacggtaagagtgagcgcggtggacat
ccagttgagcgtcgtccgatgagacagtggatgttaaaaattacagcttacggagatcgt
ctattagaagatctagacgagcttgattggccagaaagcttaaaagatatgcaacgtaac
tggatcggtcgttctgaaggtgcagaagtacacttcaacatcgacggtacagatgagaag
ttcacagttttcacaacgcgccctgatacactatttggtgcaagctactgtgtacttgct
ccggaacatgcgcttgttgctgacattacaactgctgatcaaaaagaagctgtagaagct
tacattaattctgtaaaaatgaagagtgatctagagcgtacagaacttgcgaaagagaaa
actggtgtattcactggtgcttatgcagttaacccagtaaatggtgagaaattaccaatc
tggatcgctgattacgttcttgcaacttacggaacaggtgctgtaatggcggttccagct
cacgatgagcgtgactatgaatttgcatcaacgttcaatcttccaatgaaggaagttgta
aaaggtggagatattacgaaagaagcatacacaggtgatggtgctcacgtaaactcagca
ttccttgatggtttaaataaagaagaagcaatcgcaaaaatgattgaatggcttgaagta
acgagcgcaggaaatcaaaaagtaacataccgtctacgtgactggttattcagccgtcaa
cgttactggggtgagccaattccagtaattcactgggaagatggcacaatgacagctgtg
aaagaagaagaattaccattagttcttccgaaaacagaaaacatccgtccttcaggtaca
ggtgaatcaccacttgctaacattgacgagtgggtaaatgttgttgatcctgagactggt
aaaaaaggtcgtcgtgaaacaaatacaatgccgcaatgggctggtagctgctggtattac
ctacgttacatcgatccaaacaacagcgaagcacttgtagatcctgaaaaagtaaaacaa
tggcttccagttgatatttatatcggtggtgcagaacacgctgtacttcacttactatat
gctcgtttctggcataaagtattatacgatatcggtgtagttccaacgaaagagccgttc
caacaattattcaaccaaggtatgattctaggtgaaaacaacgagaaaatgagtaaatca
aaaggtaacgttgtaaaccctgatgatatcgtagcaagccacggtgcagatacacttcgt
ctatacgaaatgttcatgggaccattagatgcttcaatcgcttggtctgaaaatggtctt
gatggagcacgtcgtttcctagatcgcgtatggcgcctattcgttcaagataacggtgaa
ttaagtgagaaaattactgatgcaccaaataaagatcttgaaaaagcttaccaccaaaca
gtcaagaaagtaacagaagactatgcagagcttcgcttcaacacagcgatttctcaaatg
atggtgttcatcaacgatgcatacaaagctgaaacacttccgaaagaatatgtagaaggt
ttcgtaaaaatgattgcaccagttgcacctcacatcggggaagagctatggagcaaactt
ggatacaatgaaacaatcacatatgcaagctggccaacatttgatgagtctaaacttgta
gaagatgaagttgaaatcgttgttcaagttatgggtaaagttcgcgcaaaactaacaatg
agtaaagacgcatcaaaagacgaaatggaaaaacttgcacttgaagcaattcaagaccaa
atcgaaggaaaaacagttcgtaaagtaattgtagttcctggaaaacttgttaacgttgtt
gcaaactaa

DBGET integrated database retrieval system