KEGG   Bacillus velezensis NAU-B3: BAPNAU_1350
Entry
BAPNAU_1350       CDS       T02859                                 

Gene name
buk
Definition
(GenBank) butyrate kinase
  KO
K00929  butyrate kinase [EC:2.7.2.7]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_1350 (buk)
Enzymes [BR:bamb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.7  butyrate kinase
     BAPNAU_1350 (buk)
SSDB
Motif
Pfam: Acetate_kinase ROK BcrAD_BadFG
Other DBs
NCBI-ProteinID: CDH95131
LinkDB
Position
1401571..1402680
AA seq 369 aa
MFEKEKRILILNPGSTSTKIGVFHNERCIFEKTLRHPEEELKTFNSIIDQYEFRKISILE
SLHEQGINISKFDAVCARGGLLRPIEGGTYEVNDAMITDLKNGYNGQHASNLGGIIAREI
ADGLNIPAYIVDPVVVDEMTPLAKVSGMPEIKRKSIFHALNQKAVARQAAASLGKRYEQM
KMIVTHMGGGTTVGVHDCGRVTDVNNGLHGEGPFSPERAGTVPAGDLVEMCFSGKYSKAD
MMKKLVGTGGLSGYLGTTDAVKVEKRIQAGDENARLIYDAMAYQVAKEIGAASAVLKGKV
DIIVLTGGLAYGKSFVSAIRSYIDWISDVLVYPGENELQSLAQGALRVLAGEEKSKQYQI
GEGVKTNGD
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttcgaaaaggaaaaacgcattctcattctgaatccaggctcaacatcaacgaaaatc
ggtgtctttcacaatgaacgctgtatctttgaaaagacgctgcggcatcccgaagaagag
ctgaaaacatttaacagcattatcgaccaatacgaatttcgaaaaataagcattcttgag
tctttacacgaacagggcatcaacatttcaaagttcgatgccgtttgtgccagaggcggc
ctgctcagaccgattgagggcggcacatatgaagtgaatgacgccatgatcactgatttg
aaaaacggctacaacggccagcatgcttctaatctgggcggaattattgccagggaaata
gctgacggattaaatatccccgcgtatatcgtcgatccggtcgtggtggatgagatgact
ccgctcgctaaagtatcaggaatgcctgaaatcaagcggaaaagcattttccatgctttg
aaccaaaaagctgttgcccgtcaggcggcggcgtccctcggcaaacggtatgaacagatg
aagatgatcgtcactcatatgggcggcggcaccacagtcggtgtccatgattgcggacgg
gtgacggatgtcaacaacgggcttcacggagaaggacccttcagcccggagcgcgcggga
accgttccggcgggtgatttggtagagatgtgtttttccggcaagtattcaaaagccgat
atgatgaaaaaacttgtcggcacgggcggactctccggctacctggggacaacggacgcg
gtgaaggtggaaaaacgcattcaggccggagatgaaaacgcgcgtctcatttatgacgcc
atggcttatcaagtagcaaaagaaatcggggcggcaagcgccgttttaaaaggaaaagta
gacattatcgtcctgacgggcggattggcgtacgggaaaagtttcgtatccgctatcaga
tcgtacatagattggatttcggatgtactggtgtacccgggagaaaatgaactgcaatct
ctcgcgcaaggcgcgcttcgggttttagccggtgaggagaagtcaaagcaatatcagatc
ggcgaaggagtgaaaacaaatggcgactga

DBGET integrated database retrieval system