KEGG   Bacillus velezensis NAU-B3: BAPNAU_1909
Entry
BAPNAU_1909       CDS       T02859                                 

Gene name
yngG
Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00072  Synthesis and degradation of ketone bodies
bamb00280  Valine, leucine and isoleucine degradation
bamb00281  Geraniol degradation
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_1909 (yngG)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAPNAU_1909 (yngG)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_1909 (yngG)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BAPNAU_1909 (yngG)
Enzymes [BR:bamb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     BAPNAU_1909 (yngG)
SSDB
Motif
Pfam: HMGL-like AFOR_C
Other DBs
NCBI-ProteinID: CDH95690
LinkDB
Position
1998078..1998977
AA seq 299 aa
MNCPKHVRINEVGPRDGLQNESAWVDTEDKIEWINMLSKTGLPYIEVTSFVHPRWIPALR
DSLDVAKGIARSEHTVYAALVPNLIGLEHAAEGGIDQACVFLSASETHNQKNVNKPIDRT
VQELRRVITEAKAEKMATRAYLSTVFGCPYEQNVPVEQVIRLSDTLLEMGVDEISLGDTI
GAANPLQVIAVLEALLPRIPASKIALHFHDTRGTALANIIPALDMGITSFDTSSGGLGGC
PYAPGSAGNAATEDVIYMLEQMGIDTGTDMNKLLYAAGWIADKIGKDLPSRNLQAFRTK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaactgtccgaaacatgtccgcatcaatgaagtaggaccgcgtgacggcttgcagaat
gaatcggcgtgggtggatacagaagataagattgagtggatcaatatgctttcaaaaaca
ggccttccctatatcgaagtgacatcattcgtgcatccgagatggattccggctcttcgt
gacagcctggacgtcgcaaaaggcattgccagatctgaacatacggtctacgcggctctc
gttccgaacctcatcggactggagcatgcggcagaaggcggaatcgatcaggcatgtgta
tttttatctgcaagcgaaacccataaccaaaaaaacgtaaacaaaccgattgaccggacc
gttcaagagctcaggcgggttattactgaagcaaaagctgaaaaaatggcgacgagagct
tatctgtccactgtgttcggctgtccgtacgaacagaacgtgccggtcgaacaagtcatc
cgcctgtcagacaccctgctcgaaatgggtgttgatgaaatatcgctcggcgacacgatc
ggcgcggcaaaccccttgcaggtcatagccgtgcttgaagcccttttgccgagaattccc
gcctcaaaaatcgcactccatttccatgatacaagaggaacggctctagcgaatatcatt
cccgctcttgatatgggcatcacatcctttgatacttcctcaggcgggcttggcggctgc
ccgtacgcccctggatcagcaggcaacgctgccacagaagacgtcatttatatgctcgaa
caaatggggattgataccgggacggacatgaataaacttctttatgccgccggctggatc
gcggataaaataggcaaagacctgccaagcagaaacctgcaggcattcagaacgaaatga

DBGET integrated database retrieval system