KEGG   Bacillus velezensis NAU-B3: BAPNAU_2310
Entry
BAPNAU_2310       CDS       T02859                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_2310 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2310 (pdhB)
   00620 Pyruvate metabolism
    BAPNAU_2310 (pdhB)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BAPNAU_2310 (pdhB)
SSDB
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Other DBs
NCBI-ProteinID: CDH96090
LinkDB
Position
complement(2484417..2485394)
AA seq 325 aa
MAQMTMIQAITDALRTELKNNENVLLFGEDVGVAGGVFRATEGLQKEFGEDRVFDTPLAE
SGIGGLALGLGLQDYRPVMEIQFFGFVYEVMDSISGQMARLRYRSGGRWTSPVTIRSPFG
GGVHTPELHADSLEGLIAQQPGIKVVIPSTPYDAKGLLIASIRDNDPVVFLEHMKLYRSF
RQEVPEEEYTIELGKADVKREGTDLSIITYGAMVHESLKAAEELEKEGVSAEVIDLRTVS
PLDIDTIIASVEKTGRAIVVQEAQKQAGIAANVVAEINDRAILSLEAPVLRVAAPDTVFP
FSLAESVWLPNHKDVLETAKKVLEF
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgcaaatgacaatgattcaagcgatcactgatgcgttacgcacagaactgaaaaac
aatgaaaacgttctgcttttcggggaagatgtaggcgttgccggaggcgtattccgtgca
actgaaggccttcaaaaagaattcggtgaggaccgcgtatttgacacgccgcttgctgaa
tccggtatcggcggtctcgctctcggtttaggcctgcaagattaccgtcctgttatggaa
atccaattcttcggattcgtatatgaagtaatggattcaatctcaggacaaatggctcgt
ctccgctaccgttccggcggacgctggacttctccggtgacaatccgttctccattcggc
ggaggggttcatacacctgaacttcacgctgacagtttggaaggccttatcgctcagcag
ccgggtattaaagttgttatcccttccactccttacgatgcaaaaggactgctgattgcc
tctatcagagacaatgatccggttgttttcttagagcatatgaaactttaccgttctttc
cgtcaggaagttcctgaggaggaatacacaatcgaacttggcaaagctgatgtgaaacgc
gaaggtactgacctttctatcatcacatacggcgcgatggttcatgagtcgcttaaggct
gctgaagagcttgaaaaagaaggcgtttctgctgaagttatcgaccttcgcactgtaagt
ccgcttgatattgatacgattattgcttctgttgaaaaaacaggccgcgcaattgtcgtg
caagaagctcaaaaacaagccggcatcgctgccaacgttgtagctgaaatcaatgaccgc
gcgattctgagcctggaagctccggttctgcgtgttgcggcgcctgatacagtatttcct
ttctcgcttgctgagagcgtatggcttccaaaccataaagacgttcttgaaactgcgaaa
aaagttcttgaattttaa

KEGG   Bacillus velezensis NAU-B3: BAPNAU_2311
Entry
BAPNAU_2311       CDS       T02859                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_2311 (pdhA)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2311 (pdhA)
   00620 Pyruvate metabolism
    BAPNAU_2311 (pdhA)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BAPNAU_2311 (pdhA)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Phage_min_cap2 RNase_J_C
Other DBs
NCBI-ProteinID: CDH96091
LinkDB
Position
complement(2485398..2486513)
AA seq 371 aa
MAAKTKTSIVDSKKQFDAIHKQFETFQILNAEGEVVNKDAMPDLSDDQLKELMRRMVYIR
ILDQRSISLSRQGRLGFYAPTAGQEASQIASHFALEQDDFILPGYRDVPQLIWHGLPLHQ
AFLFSRGHFKGNQMPEGVNALSPQIIIGAQIIQTAGVALGLKKRGKKAVAITYTGDGGAS
QGDFYEGMNFAGAFKAPAIFVVQNNRYAISTPVEKQSSAQTIAQKAVAVGITGVQVDGMD
ALAVYAATAEARQRAINGEGPTLIETLTFRYGPHTMSGDDPTKYRTKEIENEWEQKDPLV
RFRKFLENKGLWSEEEENKVIEQAKEEIKQAIKKADGESKPKVTELIENMFEEPTFNLKE
QLEIYKAKESK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggctgcaaagacaaaaacttcaattgttgatagcaaaaaacaatttgatgctattcat
aagcagtttgaaacgttccaaattttaaatgctgaaggagaagtcgtaaataaagacgca
atgcctgatctttcagatgatcagttaaaggaattaatgagaagaatggtgtatatccgc
attttagaccagcgttcaatttctctttcccgtcaaggacgtttaggtttctatgcaccg
acagcgggccaggaagcttctcaaattgcatcacacttcgcgcttgaacaggacgacttt
atccttccgggttatcgtgacgttcctcagctgatttggcacgggcttcctttacatcag
gcattcctgttctcaagaggccattttaaaggtaatcagatgcctgagggagtaaatgct
ttatcacctcaaattattatcggtgctcaaattattcaaaccgcaggtgtagctttaggt
cttaaaaagcgcggtaaaaaagcggtagctattacttacactggtgacggcggagcttct
caaggtgacttctatgaaggaatgaactttgccggagcatttaaagcgccagcgatcttc
gttgttcagaataaccgctatgcgatttcaactcctgtagaaaagcaatcatccgcacag
acaattgcccaaaaagcagttgccgtcggtattacaggtgttcaagtagacggaatggat
gcacttgccgtttacgctgcaaccgcagaagcacgccagcgcgcaattaacggtgaaggt
ccgactctgatcgaaactcttacattccgttacggacctcatacaatgtccggtgacgat
ccgactaaataccgtacgaaagaaatagaaaatgaatgggagcaaaaagacccgctcgta
cgtttccgcaagttcttggaaaacaaaggactatggtctgaagaagaagagaacaaagtg
attgaacaggccaaagaagaaatcaaacaagctatcaaaaaggctgacggcgaatcaaaa
ccgaaagtaacagagctgattgagaatatgtttgaagagccgacgttcaacttaaaagaa
caacttgaaatttacaaagcgaaggagtcgaagtaa

DBGET integrated database retrieval system