KEGG   Bacillus velezensis NAU-B3: BAPNAU_3513
Entry
BAPNAU_3513       CDS       T02859                                 

Gene name
alsD
Definition
(GenBank) acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00650  Butanoate metabolism
bamb00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_3513 (alsD)
   00660 C5-Branched dibasic acid metabolism
    BAPNAU_3513 (alsD)
Enzymes [BR:bamb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     BAPNAU_3513 (alsD)
SSDB
Motif
Pfam: AAL_decarboxy
Other DBs
NCBI-ProteinID: CDH97293
LinkDB
Position
complement(3714041..3714808)
AA seq 255 aa
MKNASDIHMMSRGEKGSPEDQIYQVSTMTSLLDGVYDGDFDMADIPKFGDFGIGTFNKLD
GELIGFDGEFYRLRGDGTATPVKGGDLSPFCSFTFFTPDMTHTIDGEMTREEFEQEIASL
LPSKNLFYAIRLDGVFKKVQTRTVERQEKPYVPMIEAVKTQPVFNFDDIQGTIAGFWTPG
YANGIAVSGYHLHFIDEGRNSGGHVFDYVIKDCKVTISQKMNMNLKLPNTTDFFNANLDN
PNFAKDIETTEGSPE
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaaacgcaagcgacatccatatgatgagccgcggagaaaaaggctcacctgaggat
cagatctatcaagtatccacaatgacatctctgctggacggagtatatgacggagatttt
gatatggctgacattccgaagttcggtgatttcggaatcggcacgttcaacaaactggac
ggcgaattaatcggatttgacggagaattttaccgtctgcgcggcgacggtacggctacg
cctgttaaaggcggagacctgtcaccattctgctcattcacattttttacgccggatatg
acgcatacgatcgacggcgaaatgacccgtgaagaattcgagcaggaaatcgccagcctt
ctgcctagtaaaaacttattttatgcgatccgtttagacggcgtatttaaaaaggtgcag
acaagaacggtagaacgccaggagaaaccgtacgttccgatgatcgaagcggtaaaaaca
cagcctgtgttcaactttgacgacatccagggtacaatcgccggcttctggacgccgggt
tacgcaaacggcatcgctgtttccggatatcacctgcacttcattgatgaaggacgcaat
tccggcggacacgtgtttgactatgtcattaaagattgtaaagtgaccatttctcaaaaa
atgaatatgaacctcaagcttccgaatacgacggactttttcaacgcaaatttagataat
ccgaattttgcgaaggacatcgaaacaaccgaaggaagcccggaataa

DBGET integrated database retrieval system