KEGG   Bacillus velezensis UCMB5113: BASU_1516Help
Entry
BASU_1516         CDS       T02796                                 

Gene name
prkC
Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bamn  Bacillus velezensis UCMB5113
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bamn01001]
    BASU_1516 (prkC)
Enzymes [BR:bamn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BASU_1516 (prkC)
Protein kinases [BR:bamn01001]
 Serine/threonine kinases: Other
  Bacterial family
   BASU_1516 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Pkinase_fungal Seadorna_VP7 PBP_N Trp_oprn_chp DUF4366 FixH
Motif
Other DBs
NCBI-ProteinID: CDG25810
LinkDB All DBs
Position
1567658..1569601
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDIDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYINAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLAVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDGEAGTVIDQDPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPEGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcctattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacattgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtcagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
aacgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcaccgggatattaaaccgcacaatata
ttgatagatcatttagggcatatcaaggtgacggatttcggaatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtctggcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggtaaaattccttttgacggagaatcagccgtcagcatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gtcgaaaacattattttaaaggcaaccgctaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgtgcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggatgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctggccgtctgtttcattttcattatg
gcagctgttcttgcggtcaccgtgttcccgtctttatttatgcctaaagatgtaagtgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggcta
cgggcggatcctgatataacggacattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaaggacggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagaaaacgatgac
ggcgaggccggcaccgtaattgatcaggacccgtcagccggcacagatatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggcccggcggacgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtgccggaaggacaagtcatgaaacaagagccgtca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgactcatttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattatcaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system