KEGG   Bacillus velezensis UCMB5113: BASU_3402
Entry
BASU_3402         CDS       T02796                                 

Gene name
bacG
Definition
(GenBank) phenylalanine aminotransferase forming tetrahydrotyrosine in bacilysin synthesis
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bamn  Bacillus velezensis UCMB5113
Pathway
bamn00998  Biosynthesis of various secondary metabolites - part 2
bamn01100  Metabolic pathways
bamn01110  Biosynthesis of secondary metabolites
Module
bamn_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bamn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BASU_3402 (bacG)
Enzymes [BR:bamn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BASU_3402 (bacG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: CDG27679
LinkDB
Position
complement(3579395..3580594)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVETLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGSPEHTERLKRTYKE
RIDFFTALCEKELGWSIEKPKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagctcagatcattaacctcgggcagggg
aatcccgatctccccacaccgccgcatatcgttgaaacattgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagctggtttgtacgttttgacgcaatgcctgctgaatcccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggaattacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctatttgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgact
ggcgcgactgcggatcaggcgttttatgaaaaagcggcagcgtttgcaaaaaaacatgac
atccaccttattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagc
tttcttcaggcgaaagaagcgaaaacggtcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggtcttcagcaggcggca
gcggcggcgctgtcaggaagtcctgagcatacggagcgtctgaagcgcacatataaagaa
cggattgactttttcacggcgttatgtgaaaaggaattaggctggagcattgaaaaaccg
aaagggactttttatgtatgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggcaaaacagggtgatttaagggaattc
gtgctgcggattcaaaagctcggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system