Bacillus velezensis AS43.3: B938_19110 Help Entry B938_19110        CDS       T02382                                  Name (GenBank) transcriptional repressor sdpR   KO K26993   ArsR family transcriptional regulator, repressor of sdpIR and other operons Organism bamp  Bacillus velezensis AS43.3 Brite KEGG Orthology (KO) [BR:bamp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bamp03000]     B938_19110 Transcription factors [BR:bamp03000]  Prokaryotic type   Helix-turn-helix    ArsR family     B938_19110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_5 HTH_20 MarR_2 HTH_24 TrmB HTH_11 HTH_IclR MarR Sigma70_r4 HTH_38 HTH_23 HTH_Crp_2 UPF0122 HTH_28 ArsR Rrf2 PuR_N EutK_C Sigma70_r4_2 Radical_SAM_C HTH_DeoR HTH_10 Fe_dep_repress HTH_37 DprA_WH DUF4423 HTH_40 Dimerisation2 Motif Other DBs NCBI-ProteinID:  AFZ92820 LinkDB All DBs Position complement(3879165..3879452) Genome browser AA seq 95 aa AA seqDB search MNKAFKALADPTRRRILDLLKKQDMTAGEIAEHFDMSKPSISHHLTILKNTDLVHDERKG QFIMYSLNTTVLQDLIGWFFSLTDSEHDNKKGGES NT seq 288 nt NT seq  +upstreamnt  +downstreamnt ttgaataaagcttttaaagcactggccgatcctacaaggagaagaattttggatttatta aagaaacaagacatgacggctggtgaaattgcggaacacttcgacatgtcaaaacccagt atttctcatcaccttaccatattgaaaaatactgatttggttcacgatgagaggaaaggc caatttattatgtattcattaaataccactgtattacaggatcttataggctggttcttt tctctgactgattcagaacatgataataagaaaggcggggaatcatga

DBGET integrated database retrieval system