KEGG   Bartonella ancashensis: PU02_1212Help
Entry
PU02_1212         CDS       T04086                                 

Definition
(GenBank) Uracil-DNA glycosylase, family 4
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
banc  Bartonella ancashensis
Pathway
banc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:banc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PU02_1212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:banc03400]
    PU02_1212
Enzymes [BR:banc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     PU02_1212
DNA repair and recombination proteins [BR:banc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PU02_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Fib_alpha
Motif
Other DBs
NCBI-ProteinID: ALE04026
UniProt: A0A0M4L8Z0
LinkDB All DBs
Position
1318625..1319452
Genome map
AA seq 275 aa AA seqDB search
MSQITHCPISYEELLNFYKESGADTALTDTPVNHFHKSHSAENEVKQISDISHNKQTLSS
LEQKSTSSYESDKMRFKDSIEEMVKNIKTLDELKSALLSFDGCSLKLTAKNTCFSDGTAG
SPLMLIGEAPGREEDIQGIPFVGRAGMLLNKILASIGLTRENVYIANTIPWRPPGNRTPT
PREIALCRPFIERQIQLANPRVLVALGGTAVQFFTGTQSGIIRMRGKWLTYETADNIKIP
VMPTFHPAYLLRTPSQKKLTWTDFLEVKSFLSNLT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaataacccactgcccaatatcatatgaagaacttttgaatttctacaaagaa
agtggtgccgatactgctctgacagatacacctgttaaccacttccataaatcacattct
gcagaaaatgaagttaaacaaataagcgacatctcccataataaacaaacgttatcttct
cttgaacaaaagagcacttcatcctacgaatctgacaaaatgcgattcaaggactcaata
gaagagatggtaaaaaatatcaaaacacttgatgaattgaaatctgctctcctttctttt
gatggctgctcactaaaattgacagcaaaaaacacttgtttttcagatggaacagcagga
agccctctaatgctcataggtgaagctccaggacgagaagaagatatacaaggcatcccc
tttgtgggaagagcaggtatgctactcaataaaatacttgcttctatcggcttaaccaga
gaaaatgtttacatagccaatactattccatggcgaccacctgggaatcgcacacccaca
ccaagagaaatagctctgtgtcgccctttcattgaacgtcaaattcagcttgctaaccct
cgcgtcctcgtggcactaggaggaaccgctgtacaattttttacaggaacccaaagtggc
attatccgtatgagaggaaaatggttaacctatgaaactgctgacaacattaaaatacct
gttatgccaacttttcaccctgcctacctcctacgaaccccaagccaaaaaaaacttaca
tggacagactttttggaagtaaaaagttttttaagcaatcttacgtaa

DBGET integrated database retrieval system