KEGG   Bifidobacterium animalis RH: EN10_04835Help
Entry
EN10_04835        CDS       T03481                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
banm  Bifidobacterium animalis RH
Pathway
banm00500  Starch and sucrose metabolism
banm01100  Metabolic pathways
banm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:banm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EN10_04835
Enzymes [BR:banm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EN10_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AIA32955
LinkDB All DBs
Position
complement(1089580..1091082)
Genome map
AA seq 500 aa AA seqDB search
MAIDKPNHETMLQCFEWYLPESHNLWRWLSSQAPSVAHAGFTTAWLPPAYKGQAGDSDVG
YGVYDMYDLGEFDAKGSVPTKYGSRMEYLQAIRAMQGNGVRVFADIVFNHRMGADGTEPV
RTHEVNVDDRTRSDSTVVERTLNTVYDFPERGGVYSTFKWNWSDFTGTDYTTDDGTTGIM
RFDGKQWSDNVSHERGNFDYIMGDDVDVNEPEVARELTDWGIWYTTTTGVDGFRLDAVKS
IDAGFFAPWLRTMQRYGNHPGIAVGEYWSGDASELTSYLHDCNHCMMLFDVALHFRFEQA
SKNPEGFDLRGLAADTLYEREPTYACTFVDNHDTQPGQALESWVQPWFKPLAYACILLRD
NVLPCVFFGDYYGVPHDLIPPMRFLPHMVWIRAHLLGDQVEAQPGDTAHSLCWVVEGNHP
VCVVLNTGSSEVHRQVRNAALASHTLIDVCHPDAPATTDTQGQGMMRCPPRSCAIYIDAD
DYGVMLEALSGTPAAGTVCA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagacaaaccaaaccatgagaccatgttgcaatgcttcgaatggtacctgccc
gaaagccacaacctatggagatggctctcatcgcaggcgccgagcgtggcccatgccgga
ttcaccacagcttggcttccacctgcgtacaaggggcaggccggcgattcagacgtggga
tatggcgtctatgacatgtacgatcttggagagttcgatgccaaaggctctgttcccacc
aaatacggctcccgcatggagtaccttcaggcgattcgcgcgatgcagggcaatggtgtt
cgtgtattcgcggacatcgtgttcaaccaccgcatgggtgccgatggaacggaacccgtg
cgcacacatgaagtgaatgtggacgaccgcacgagaagcgactccaccgtggtcgaacgc
accttgaacaccgtatacgatttccccgaacgcggcggcgtgtattcgacattcaaatgg
aactggagcgatttcaccggcaccgattacacgaccgatgatggcacgacgggcatcatg
cgtttcgacggcaagcagtggagcgacaatgtgagccatgaacgcggcaacttcgattac
atcatgggagatgacgtcgatgtcaacgaacctgaggtcgccagagagcttacggattgg
ggcatatggtatacgacgaccacaggagtggacggcttccggctcgatgcggtgaaaagc
atcgacgccggattcttcgcgccatggttgcgcacgatgcaacgatacggcaatcatccc
ggcattgccgtgggtgagtactggtcgggtgacgcgagcgagctgacctcgtacctgcat
gattgcaaccattgcatgatgctgttcgatgtcgcgctccatttccgcttcgaacaggcc
tcaaagaacccagagggattcgatctgcggggacttgccgcagacacgctgtatgagcgt
gaaccgacgtatgcatgcaccttcgtggacaaccatgacacacaacccggtcaggcgctc
gaatcctgggtgcaaccatggttcaaaccgttggcgtacgcatgcattctgctacgcgac
aacgtgttgccttgcgtgttcttcggcgattactacggcgtaccccacgatctcatcccg
ccaatgaggttcctgccgcacatggtgtggatccgcgcgcatctgctgggggatcaggtg
gaggcgcagccaggcgataccgcccattcgctgtgctgggtggtggaaggaaatcacccg
gtgtgcgtggtgctcaacaccgggagcagcgaggtccatcgacaggttcgcaatgcggcg
ctcgcctcgcacacgcttatcgacgtatgccatcctgatgccccggcgacgactgacacg
caggggcagggcatgatgcgatgccctccgcggtcatgcgccatctatattgatgcggac
gattatggggtgatgttggaagcgttgtccggcacgcccgcagctgggactgtatgcgcc
tga

DBGET integrated database retrieval system