KEGG   Bartonella sp. 1-1C: B11Cv2_012230Help
Entry
B11Cv2_012230     CDS       T05463                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
baro  Bartonella sp. 1-1C
Pathway
baro00020  Citrate cycle (TCA cycle)
baro00190  Oxidative phosphorylation
baro00650  Butanoate metabolism
baro01100  Metabolic pathways
baro01110  Biosynthesis of secondary metabolites
baro01120  Microbial metabolism in diverse environments
baro01130  Biosynthesis of antibiotics
baro01200  Carbon metabolism
Module
baro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
baro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:baro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B11Cv2_012230
   00650 Butanoate metabolism
    B11Cv2_012230
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B11Cv2_012230
Enzymes [BR:baro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B11Cv2_012230
    1.3.5.4  fumarate reductase (quinol)
     B11Cv2_012230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATO57961
UniProt: E6YX51
LinkDB All DBs
Position
complement(1365064..1366908)
Genome map
AA seq 614 aa AA seqDB search
MVRAISSLGARVGRAAYNYVDHKFDVVVVGAGGAGLRATLGMAEQGLRTACITKVFPTRS
HTVAAQGGIAASLSNMGPDNWQWHLYDTVKGSDWLGDTDAMEYLVRNAPAAVYELEHYGV
PFSRTQEGKIYQRPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFVE
YFALDLIMTDGVCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGG
MIARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSFKDLA
SRDLVSRCITLEIREGRGVGAKKDHIHLVLNHIDPAILHERLPGISESARIFAGVDLTKE
PIPVLPTVHYNMGGIPTNYYGEVLNPTLDSPDRVQPGLMAVGEAGCASVHGANRLGSNSL
IDLVVFGRAAAIRAGEVIDRDAEIPALNEAAVDAIIARFDRLRFAQGQVPTAMLREKMQR
AMQEDAAVFRTADSLEQGCQRISKIWDELSDLKVTDRSLIWNSDLMETLELENLMANAIT
TVYSAAARLESRGAHAREDYPERDDKNWRRHTLSHLSQDGKVILSYRPVHVDPLTSEEDG
GIDLKRIMPKKRVY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggtgagagcaatatcatctctaggtgctagagtggggcgtgctgcctataactatgtt
gatcataaatttgatgttgtggttgttggtgctgggggagctggtttgcgtgcaaccctt
ggtatggctgagcaaggattaagaacagcatgtatcacaaaagtttttccaacgcgatca
catacagttgcagcgcaaggcggtattgcagcatccttgtcgaatatggggcctgataat
tggcaatggcatttatatgatacggtgaaaggatctgattggcttggcgataccgatgca
atggaatatttagtgcgaaatgcacccgcagctgtttatgaattagaacattatggagtt
cctttttcgcgtacgcaagaagggaaaatttatcaacgtccttttggtggtcataccaca
gagtttggtgaaggcccaccagtccaacgtacttgtgctgcagctgatcgtactggtcat
gcaattttgcatacgctttatgggcaaagccttaagcataatgcgcagttttttgttgaa
tattttgcccttgatttgatcatgacagatggtgtgtgtacgggtgttgtcgcttggaat
cttgatgatggtacaattcatcgtttttctgcgaagatggttgttctcgccactggcggt
tatgggcgggcttatttttcagcaacatcagcgcatacatgtacaggtgatggtggtggg
atgattgctcgagctgggttaccgcttcaggatatggaatttgttcaatttcatcctaca
ggaatttatggttctggttgcttaattacagaaggtgcacgtggtgaaggtggctattta
gtgaattctgaaggtgagcgctttatggaacgttatgcaccatcttttaaggatttggca
tcacgtgatttggtttcacgttgtatcacacttgaaattcgggaagggcgtggtgttggt
gcgaaaaaagatcatattcatttggtccttaatcatattgatccagctatattgcatgag
cgtttaccggggatttctgaatcagcccgaatttttgcaggggttgatttgacaaaagag
ccaattcctgttttgccaacagttcattataatatgggtggtattcctaccaattactat
ggagaagttttaaatccaacccttgattctcctgatcgtgttcaaccaggtttgatggct
gtgggtgaggcaggatgtgcatctgttcatggcgctaatcgtttaggatcaaattcattg
attgatttagtcgtttttggacgtgctgctgcaattcgtgcaggagaagtcatcgatcgc
gatgcagagatcccagctcttaatgaagccgcagttgatgcaattatagcacgttttgac
cgtttacgttttgctcaaggacaggttccaacagctatgctgcgtgaaaaaatgcagcgt
gcgatgcaagaggatgctgcggtattccgtacagcagattctttagagcagggatgtcaa
cggatcagtaaaatttgggacgaactttctgaccttaaagtaacagatcgttcacttatt
tggaattctgatttaatggaaacattagagcttgaaaatttgatggcaaatgcaattacg
actgtttattctgcagctgctcgtttggaaagtcgtggtgctcatgcacgagaagattat
ccagagcgtgatgataaaaattggcgtcgccatacactttcgcatctatctcaggatgga
aaggtgatattatcgtaccgtcctgttcatgttgatccattaacgtctgaagaagatggt
ggtatagatttaaagcgtattatgcctaaaaagcgtgtttattaa

DBGET integrated database retrieval system